KEGG   Mageeibacillus indolicus: HMPREF0868_1200Help
Entry
HMPREF0868_1200   CDS       T01181                                 

Definition
(GenBank) RNA polymerase sigma factor, sigma-70 family
Organism
clo  Mageeibacillus indolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4_2 Sigma70_r4 UPF0122 HTH_23 HTH_17 HTH_5 HTH_IclR HTH_38 HTH_28 DUF1492 Phage_antitermQ Terminase_5 HTH_54 HTH_7
Motif
Other DBs
NCBI-ProteinID: ADC91773
UniProt: D3R2S4
Position
553520..553942
Genome map
AA seq 140 aa AA seqDB search
MKPSSFQTTIENQFDYICKRAMEDERKNYMLYLSRIAKREVSFSDVGDYLVSQFATTDNY
STDFQIFTLNGLSVGVENDLLSEALRELPDKKREILLLFYFMDMSDSEIADLLKLNRSTV
YRHRTSGLALIKKFMEEFEE
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccatcttcttttcagaccacaatagaaaatcagtttgactatatctgtaaacgt
gctatggaagacgagcgaaagaattatatgctttatctttcaaggattgcaaagcgtgag
gtgtccttttcggatgttggcgattatcttgttagccagtttgcgacaacagataactat
tcaactgactttcagatttttacactcaatgggttatcagtaggcgttgaaaatgatttg
ttgagtgaagcattacgtgagttgccagacaagaaacgtgaaattctactgctgttttac
tttatggacatgagcgattcagaaattgcagacctgttgaaattgaaccgttctactgtc
tatcggcatagaaccagtggactagccttaattaaaaagtttatggaggaatttgaagaa
tga

DBGET integrated database retrieval system