KEGG   Mageeibacillus indolicus: HMPREF0868_1201Help
Entry
HMPREF0868_1201   CDS       T01181                                 

Definition
(GenBank) DNA-binding helix-turn-helix protein
Organism
clo  Mageeibacillus indolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DBD_HTH HTH_3 HTH_31 HTH_19 HTH_25
Motif
Other DBs
NCBI-ProteinID: ADC91354
UniProt: D3R2S5
Position
complement(552662..553015)
Genome map
AA seq 117 aa AA seqDB search
MRKKEDKYDFRAFGLAIKEARLKRGLTREQVGALIEIDPRYLTNIENKGQHPSIQVLYDL
VSLLHVSVDEFFLPANNLVKSTRRLQIEKYMDSFTDKELSLMESLASGINEARNIED
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaaaagaagataaatatgattttagagcctttggtttagccattaaagaagct
cgattgaaacgaggtttaactcgtgaacaagtgggagcattgattgaaattgacccacgg
tacttaactaatattgaaaataaagggcaacaccccagcatacaagttctttatgacctt
gtatcgttacttcatgtttccgttgatgaatttttcttacctgctaataacttggtaaaa
agcacccgacgattacagatagagaaatacatggatagctttacagacaaagaactatcc
ttaatggaatctttagccagcggtatcaacgaagcaagaaacatcgaagactaa

DBGET integrated database retrieval system