KEGG   Mageeibacillus indolicus: HMPREF0868_1202Help
Entry
HMPREF0868_1202   CDS       T01181                                 

Definition
(GenBank) putative translation elongation factor G
  KO
K18220  ribosomal protection tetracycline resistance protein
Organism
clo  Mageeibacillus indolicus
Brite
KEGG Orthology (KO) [BR:clo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:clo01504]
    HMPREF0868_1202
Antimicrobial resistance genes [BR:clo01504]
 Gene variants
  Tetracycline resistance genes
   Others
    HMPREF0868_1202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU EFG_IV EFG_C EFG_II MMR_HSR1 GTP_EFTU_D2 RF3_C Cerato-platanin AIG1 Septin FeoB_N
Motif
Other DBs
NCBI-ProteinID: ADC90616
UniProt: D3R2S6
Position
550397..552316
Genome map
AA seq 639 aa AA seqDB search
MKIINIGVLAHVDAGKTTLTESLLYNSGAITELGSVDRGTTKTDNTLLERQRGITIQTAI
TSFQWKNTKINIIDTPGHMDFLAEVYRSLSVLDGAILLISAKDGVQAQTRILFHALRKIG
IPTIFFINKIDQNGIDLSTVYQDIKEKLSAEIVIKQKVELHPNMRVMNFTESEQWDMVIE
GNDYLLEKYTSGKLLEALELEQEESIRFHNCSLFPVYHGSAKNNIGIDNLIEVITNKFYS
STHRGQSELCGKVFKIEYSEKRQRLAYIRLYSGVLHLRDSVRISEKEKIKITEMYTSING
ELCKIDKAYSGEIVILQNEFLKLNSVLGDTKLLPQRERIENPLPLLQTTVEPSKPQQREM
LLDALLEISDSDPLLRYYVDSATHEIILSFLGKVQMEVTCALLQEKYHVEIEIKEPTVIY
MERPLKKAEYTIHIEVPPNPFWASIGLSVAPLPLGSGVQYESSVSLGYLNQSFQNAVMEG
IRYGCEQGLYGWNVTDCKICFKYGLYYSPVSTPADFRMLAPIVLEQVLKKAGTELLEPYL
SFKIYAPQEYLSRAYNDAPKYCANIVDTQLKNNEVILSGEIPARCIQEYRSDLTFFTNGR
SVCLTELKGYHVTTGEPVCQPRRPNSRIDKVRYMFNKIT
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattaatattggagttttagctcatgttgatgcgggaaaaactaccttaaca
gaaagcttattatataacagtggagcgattacagaattaggaagcgtggacagaggtaca
acgaaaacggataatacgcttttagaacgtcagagaggaattacaattcagacggcgata
acctcttttcagtggaaaaatactaagataaacatcatagacacgccaggacatatggat
tttttagcagaagtatatcgttcattatcagtattagatggggcaattctactgatttct
gcaaaagatggcgtacaagcacaaactcgtatattgtttcatgcacttaggaaaataggt
attcccacaatcttttttatcaataagattgaccaaaatggaattgatttatcaacggtt
tatcaggatattaaagagaaactttctgcggaaattgtaatcaaacagaaggtagaactg
catcctaatatgcgtgtaatgaactttaccgaatctgaacaatgggatatggtaatagaa
ggaaatgattaccttttggagaaatatacgtctgggaaattattggaagcattagaactc
gaacaagaggaaagcataagatttcataattgttccctgttccctgtttatcacggaagt
gcaaaaaacaatatagggattgataaccttatagaagtgattacgaataaattttattca
tcaacacatcgaggtcagtctgaactttgcggaaaagttttcaaaattgagtattcggaa
aaaagacagcgtcttgcatatatacgtctttatagtggcgtactgcatttgcgagattcg
gttagaatatcggaaaaggaaaaaataaaaattacagaaatgtatacttcaataaatggt
gaattatgtaaaatcgataaggcttattccggggaaattgttattttgcagaatgagttt
ttgaagttaaatagtgttcttggagatacaaagctattgccacagagagagagaattgaa
aatcccctccctctgctgcaaacgactgttgaaccgagcaaacctcaacaaagggaaatg
ttacttgatgcacttttagaaatctccgacagtgacccgcttctgcgatattatgtggat
tctgcgacacatgaaatcatactttctttcttagggaaagtacaaatggaagtgacttgt
gctctgctgcaagaaaagtatcatgtggagatagaaataaaagagcctacagtcatttat
atggaaagaccgttaaaaaaagcagagtataccattcacatcgaagttccaccgaatcct
ttctgggcttccattggtctatctgtagcaccgcttccattagggagcggagtacagtat
gagagctcggtttctcttggatacttaaatcaatcgtttcaaaatgcagttatggagggg
atacgctatggctgtgaacaaggattgtatggttggaatgtgacggactgtaaaatctgt
tttaagtatggcttatactatagccctgttagtaccccagcagattttcggatgcttgct
cctattgtattggaacaagtcttaaaaaaagctggaacagaattgttagagccatatctt
agttttaaaatttatgcgccacaggaatatctttcacgagcatacaacgatgctcctaaa
tattgtgcgaacatcgtagacactcaattgaaaaataatgaggtcattcttagtggagaa
atccctgctcggtgtattcaagaatatcgtagtgatttaactttctttacaaatggacgt
agtgtttgtttaacagagttaaaagggtaccatgttactaccggtgaacctgtttgccag
ccccgtcgtccaaatagtcggatagataaagtacgatatatgttcaataaaataacttag

DBGET integrated database retrieval system