KEGG   Mageeibacillus indolicus: HMPREF0868_1203Help
Entry
HMPREF0868_1203   CDS       T01181                                 

Definition
(GenBank) tetracycline resistance determinant leader peptide
Organism
clo  Mageeibacillus indolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetM_leader uDENN
Motif
Other DBs
NCBI-ProteinID: ADC90627
UniProt: D3R2S7
Position
550265..550381
Genome map
AA seq 38 aa AA seqDB search
MILKYPENICMLCMPMVMHKNPSDKSIYHWDFYALLGF
NT seq 117 nt NT seq  +upstreamnt  +downstreamnt
gtgattctaaagtatccggagaatatctgtatgctttgtatgcctatggttatgcataaa
aatcccagtgataagagtatttatcactgggatttttatgcccttttgggcttttga

DBGET integrated database retrieval system