KEGG   Mageeibacillus indolicus: HMPREF0868_1204Help
Entry
HMPREF0868_1204   CDS       T01181                                 

Definition
(GenBank) hypothetical protein
Organism
clo  Mageeibacillus indolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TpcC NuiA
Motif
Other DBs
NCBI-ProteinID: ADC90887
UniProt: D3R2S8
Position
549103..550020
Genome map
AA seq 305 aa AA seqDB search
MMKFRKNQNKEKQIPKEKKPRVYYKVNPHKKVVIALWVLLGLSFSFAIFKHFTAIDTHTI
HETTIIEKEYVDTHHVENFVENFAKVYYSWEQSDKSIDNRMESLKGYLTDELQALNVDTV
RKDIPVSSSVRGFQIWTVEPTGDNEFNVTYSVDQLITEGENTKTVHSAYIVSVYVDGSGN
MVLVKNPTITNIPKKSSYKPKAIESEGTVDSITTNEINEFLTTFFKLYPTATASELSYYV
NDGILKPIGKEYIFQELVNPIHNRKDNQVTVSLTVEYIDQQTKATQVSQFDLVLEKNGSN
WKIIE
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatttagaaaaaatcagaataaagaaaaacagataccaaaggaaaagaaacct
cgtgtctactataaggtcaatcctcataaaaaggttgtgattgccttgtgggtactttta
gggcttagtttcagctttgcgatattcaagcactttacagctatagatactcatactatt
cacgaaacaactatcatagaaaaggaatacgttgatactcatcatgtagaaaattttgta
gagaactttgcgaaagtctactattcatgggagcaatccgataagtccattgataatcga
atggaaagtctaaaaggctatctgacagatgaacttcaagctctcaatgttgatacagta
cgcaaagatattcctgtatcgtcttctgtaagaggatttcagatatggacggtagagcca
actggcgacaatgagtttaatgtaacctacagtgtagaccagctcattacagagggagaa
aatacaaagaccgtccactctgcttatatagtgagtgtctatgtagatggttctggaaat
atggtactggttaagaatccgaccattaccaacatacctaagaaatcaagttataaacca
aaagccattgaaagtgaggggacggttgattccattacaaccaatgaaatcaatgagttt
ttaacgacgttcttcaagctctatcctacagcgacagccagtgaactttcctactatgtg
aatgacgggatattaaaaccaatcggaaaagagtacatctttcaagaactggtaaatcct
attcacaatcgtaaggataatcaagtcacggtatcgctgacagtggagtatatcgaccag
cagaccaaagcaacgcaggtatctcaatttgatttggtacttgaaaagaacgggagtaat
tggaagattatagaataa

DBGET integrated database retrieval system