KEGG   Mageeibacillus indolicus: HMPREF0868_1205Help
Entry
HMPREF0868_1205   CDS       T01181                                 

Definition
(GenBank) NlpC/P60 family protein
Organism
clo  Mageeibacillus indolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lysozyme_like NLPC_P60 SLT DUF1175 CHAP
Motif
Other DBs
NCBI-ProteinID: ADC91579
UniProt: D3R2S9
Position
548087..549088
Genome map
AA seq 333 aa AA seqDB search
MKLKTLVIGGSGLFLMVFSLLLFVAILFSDEQDSGISNIHYGGVNVSAEVLAHKPMVEKY
AKEYGVEEYVNILLAIIQVESGGTAEDVMQSSESLGLPPNSLSTEESIKQGVKYFSELLA
SSERLSVDLESVIQSYNYGGGFLGYVANRGNKYTFELAQSFSKEYSGGEKVSYPNPIAIP
INGGWRYNYGNMFYVQLVTQYLVTTEFDDDTVQAIMDEALKYEGWRYVYGGASPTTSFDC
SGLTQWTYGKAGINLPRTAQQQYDVTQHIPLSEAQAGDLVFFHSTYNAGSYITHVGIYLG
NNRMFHAGDPIGYADLTSPYWQQHLVGAGRIKQ
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgaaaactttagtgattggtggttctggattattcttgatggtcttctcactg
cttctgtttgttgccattttattttcagatgaacaggacagcggaatttccaatattcat
tatggaggtgtgaatgtttccgcagaagtgctggctcataagcctatggtagaaaaatat
gccaaagaatatggcgttgaagaatatgtcaacatacttcttgcgattatacaggtggaa
tcgggcggtactgcggaagatgttatgcagtcctcggaatccctcggtcttccacctaat
tcattgagtacagaagaatccattaagcaaggtgtgaagtatttcagtgaattattagcc
agtagcgaaaggctcagtgtagatttagaatcggttatccagtcctacaattatggtggt
ggtttcttagggtatgtggctaatcgtggaaataaatatacctttgaactggctcaaagt
ttctcaaaagagtattcaggtggcgaaaaagtgtcttaccccaatcccatagccatacct
atcaatgggggctggcgatacaactatggcaatatgttttatgtgcaactggtaacgcag
tatcttgtcacaacagagtttgatgatgatacggtacaagccatcatggacgaagcactg
aaatatgagggctggcgatacgtttacggtggagcttccccgactacttcttttgattgt
agcggactgacacaatggacgtatggaaaagctggaattaacttaccacgaaccgcacaa
cagcaatatgatgtgacccagcatatcccactatcggaagcacaagctggcgatttggtt
ttctttcattctacctataacgctggctcttatattactcatgttgggatataccttggc
aataaccgtatgtttcatgcaggcgacccaatcggttatgccgacttaacaagcccctac
tggcaacagcatttagtgggagcaggacgaatcaaacaatga

DBGET integrated database retrieval system