KEGG   Mageeibacillus indolicus: HMPREF0868_1206Help
Entry
HMPREF0868_1206   CDS       T01181                                 

Definition
(GenBank) hypothetical protein
Organism
clo  Mageeibacillus indolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbL YtxH
Motif
Other DBs
NCBI-ProteinID: ADC91103
UniProt: D3R2T0
Position
545913..548090
Genome map
AA seq 725 aa AA seqDB search
MKPSIVNRIKSNWTLKRLGKVAMTVAFTLVIAIFLLAMLGTVVQAAGLVDDTVNVANEYS
RYPLENYQLDFYVDNSWGWLPWNWSDGIGKQVMYGLYAITNFIWTISLYVSNATGYLVQE
AYSLDFISATADSIGKNMQTLAGVSANGFSTEGFYVGFLLLLILVLGVYVAYTGLIKRET
TKAIHAIMNFVLVFILSASFIAYAPDYIKKINDFSSDISNASLSLGTKIVMPHSDSQGKD
SVDLIRDSLFSIQVQQPWLLLQYNSSDIESIGIDRVESLLSTSPDSNNGEDREKIVAEEI
EDRSNTNLTITKTINRLGTVFFLFVFNIGISIFVFLLTGIMIFSQVLFIIYAMFLPVSFI
LSMIPSFDGMSKRAITKLFNTILTRAGITLIITTAFSISTMLYTLSAGYPFFLIAFLQIV
TFAGIYFKLGDLMSMFSLQSNDSQSVGSRVMRKPRMLMHAHMHRLQRKLGRSMTTLGAGS
AIVTGKKGQSGSGSSARTQADHSRPDGKEKSTLGKRIGQTIGTVADTKDRMVDTASGLKE
QVKDLPTNARYAVYQGKSKVKENVRDLTSSISQTKADRASGRKEQQEQRRKTIAKRRSEM
EQVKQKKQPASSVHERPTTRQEQYHDEQTSKQSNIQTSYKESQQAKQERPAVKSDFSSPK
VERQGNTVQEKTVQKPATSTTTADRTSQRPITKERPSTVQRVPLQNTRSRPPIKTATIKK
VGKKP
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccatcaatagtaaacagaataaaatcaaactggacgctgaaacgtctaggtaaa
gtggcaatgacagtggctttcacacttgtgattgccatttttcttttagccatgctggga
acggtggttcaagctgcgggcttggtagatgatacggtcaatgtggcaaatgaatacagc
cgatacccacttgaaaactatcaactggatttttatgtggataatagctggggctggctt
ccgtggaactggtcggacgggattggaaaacaggtcatgtatggactatatgccattacc
aattttatttggacaatcagtttgtatgtttccaatgcgacaggttacttagtacaggaa
gcctattccttagacttcatttccgctacagcagattccattggtaagaatatgcagacc
ttagctggtgtgagtgcaaacggattttcaacagagggtttctatgttggattcctctta
ctcttgattttggttcttggggtttatgttgcctatacgggactgataaagagagaaacc
acaaaggcaattcatgccattatgaattttgtgctggtgtttatcctatcggcttccttt
attgcctacgctcccgactacattaaaaaaatcaatgacttttcatcagacatcagtaat
gccagtttatcacttggcacgaagattgtcatgccccattccgatagtcaaggcaaggac
agcgtggacttaatcagagatagcctgttttccatacaggttcagcaaccgtggctactg
cttcaatacaacagttcagacattgaaagtatcggtattgaccgtgtggaaagcctgctc
tccaccagcccagattccaacaatggcgaagacagagaaaaaattgttgcggaagaaatt
gaagacagaagcaataccaatctaaccattacaaagaccattaaccgtttaggtacagtc
ttcttcctatttgtcttcaatattgggatttccatatttgtattcctattaacaggaatc
atgattttctcgcaggtactttttatcatctatgctatgtttctgcctgtgagctttatt
ttaagcatgattccatcatttgatggtatgtcaaaacgagccataacaaagctctttaat
accattttgacacgagctggaatcacattgattattacgacagcatttagtatttcaacc
atgctctataccttatcggctggttatccgttctttttgattgcttttctacagattgtg
acctttgcaggaatctacttcaagctgggcgatttaatgagtatgttttctctacagagt
aacgattctcaaagtgtgggaagtcgtgtgatgagaaaacctcgtatgcttatgcacgct
cacatgcaccgtctacagcggaaacttggacgttccatgactactctaggggctgggtct
gccattgttacaggtaaaaaaggacagtcgggttcggggagttctgcaaggacacaagca
gatcactcccgaccagacggaaaggaaaaatcaacacttggaaaacgtatcggtcaaacc
atcggtacagtagctgataccaaagacagaatggtagacactgctagtggtttgaaagaa
caggttaaagatttgccgaccaatgcaagatatgcagtatatcaaggaaaatccaaagta
aaagagaatgtccgtgatttaaccagtagtatttctcaaaccaaagcggacagagccagt
ggacgcaaggaacagcaggaacaaaggcgaaaaaccattgcgaagcgtcgctctgaaatg
gaacaggtcaaacagaaaaaacagcctgcttcttctgttcatgaaagaccgactacaaga
caagaacaatatcatgatgaacagacctcaaaacagtctaatattcagacttcatataag
gaatctcaacaagccaaacaagagcgtccagcagttaagtccgatttttcaagtccaaaa
gtggaacgccaaggcaataccgttcaagaaaaaaccgttcaaaagccagcaacttcaacc
actacagcagatagaacttcacaacgtccaatcacaaaagaacgtccgtctactgttcaa
agagtaccactacaaaatacaagaagtagaccaccaatcaaaaccgccaccattaagaaa
gtcggtaagaaaccatga

DBGET integrated database retrieval system