KEGG   Mageeibacillus indolicus: HMPREF0868_1207Help
Entry
HMPREF0868_1207   CDS       T01181                                 

Definition
(GenBank) hypothetical protein
Organism
clo  Mageeibacillus indolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_10 DUF853
Motif
Other DBs
NCBI-ProteinID: ADN43923
UniProt: E1PK68
Position
544576..545910
Genome map
AA seq 444 aa AA seqDB search
MKDFYDDLSVKLVRPFGDMLGLHEEFLPASKRYMNDYIQYVTSDFLAGLGFGATQMLGEN
EGIYVGYSLDTGRNVYLKPALASQGVKGSVTNALASAFVGSLGGGKSFANNLIVYYAVLY
GAQAVIVDPKAERGRWKETLPEISHEINIVTLTSDEKNKGLLDPYVIMKNPKDSESLAID
ILTFLTGISSRDGERFPILRKAIRAVTNSEVRGLMKVIEELRVENTPLSTSIADHIESFT
DYDFAHLLFSNGYVEQSISLEKQLNIIQVADLVLPDKETSFEEYTTMELLSVAMLIVIST
FALDFIHTDRSIFKIVDLDEAWSFLQVAQGKTLSMKLVRAGRAMNAGVYFVTQNTDDLLD
EKLKNNLGLKFAFRSTDLNEIKKTLAFFGVDPEDENNQKRLRDLENGQCLISDLYGRVGV
IQFHPVFEELLHAFDTRPPVRKEV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagatttttatgacgatttaagcgtaaaactggtacgaccatttggggatatgctc
ggcttacatgaagaatttttacctgccagcaagcgttatatgaatgattatattcaatac
gtgacctctgatttcctcgctggtttaggttttggtgctactcaaatgctgggggaaaat
gaggggatttatgttggctacagcttagatactggacgcaatgtctatctgaaacctgct
cttgccagtcaaggggttaagggttcagtaaccaatgcgttagcgtcggcttttgttggt
tcgctgggtggtggtaaatcctttgcgaataaccttatcgtctattatgcggtgctttat
ggggcacaagcagtgattgtagacccaaaagcagaacgtggcagatggaaagaaaccttg
ccagagatttcccatgaaatcaatatcgtcactctgacttctgatgagaaaaacaaaggc
ttacttgacccttatgtgattatgaaaaatcccaaagattctgaatcactggctattgat
attctgacattccttacggggatttcctctcgtgatggggaacgcttcccaatccttaga
aaagccattcgtgcagtaaccaatagtgaagtacgagggttgatgaaagtgattgaggaa
ttacgggttgagaatacgccactaagtaccagtatagccgaccatatcgaaagttttaca
gactatgactttgcacatttattattcagtaatggttatgtggagcagtctatcagctta
gaaaaacaactgaacattatacaggttgcggacttggtacttcccgacaaggaaacttcc
tttgaggaatataccactatggagcttttatccgttgctatgctgattgtcattagtacc
tttgctttagactttatccatacagaccgaagcattttcaagattgtagatttagacgaa
gcatggagctttttacaggtagcacaaggaaaaacactatctatgaagctggttcgggct
ggtcgtgctatgaacgctggggtatatttcgtgacccaaaatacagacgacctcttagat
gaaaaactgaaaaataacctcggcttaaaatttgcatttcgttccactgaccttaacgag
attaaaaagaccttagccttttttggtgtagacccagaggacgaaaacaatcagaagcga
ttgcgtgatttggaaaacgggcaatgccttatcagtgatttatatggtcgtgtcggtgtg
atacagttccaccctgtatttgaagaactgctccatgcctttgataccagaccacctgtg
cgaaaagaggtgtaa

DBGET integrated database retrieval system