KEGG   Mageeibacillus indolicus: HMPREF0868_1208Help
Entry
HMPREF0868_1208   CDS       T01181                                 

Definition
(GenBank) hypothetical protein
Organism
clo  Mageeibacillus indolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IMD
Motif
Other DBs
NCBI-ProteinID: ADN43922
UniProt: E1PK67
Position
543464..544579
Genome map
AA seq 371 aa AA seqDB search
MAYPIKYIENNLVWNKDGECYAYYELVPYNYSFLSPEQKIQVHDSFRQLIAQNRDGKIHA
LQISTESSIRSAQERSKNEVTGKLKAVAYDKIDQQTDALISMIGENQVNYRFFIGFKLLL
NDQEFSMKSLTVEAKNALSDFVYDVNHKLMGDFVSMSNDEILRFQKMEKLLENKISRRFK
IRRLDKDDFGYLIEHLYGQTGTAYEEYEYHLSKKKLDNETLIKYYDLIKPTRCLVEEKQR
YLKIQQEDETVYVAYFTINSIVGELDFPSSEIFYYQQQQFTFPIDTSMNVEIVANRKALS
TVRNKKKELKDLDNHAWQSDNETSSNVAEALESVNELETNLDQSKESMYKLSYVVRVSQM
ILTNSNVVVMK
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcatatccaattaaatacattgaaaacaatctcgtctggaataaagacggggaatgt
tatgcttactatgagcttgttccttacaattactcatttctaagtccagaacagaaaata
caagtgcatgattctttcagacagcttatcgcacaaaatcgtgatggcaaaattcatgct
ttacaaatcagtacagaatccagcatacgttctgcacaagagcgttccaaaaatgaagtc
actggcaagctcaaagcggttgcctatgacaaaatcgaccaacagacagacgctttaata
tccatgattggcgaaaatcaagtgaactaccgtttctttatcggctttaagttgcttctc
aacgatcaggagttttctatgaaaagtcttaccgttgaagcaaaaaatgctttgtctgat
tttgtctatgatgtgaaccataagctgatgggcgattttgttagtatgagtaatgatgaa
atcctgcgttttcagaagatggaaaagctcttagaaaataaaatctctcgtcgtttcaaa
atccgcaggttagataaggacgacttcggctatctgattgaacacctttacggacagaca
ggcactgcctatgaagagtatgagtaccatctatcaaagaaaaagctggataatgaaacg
ctgattaaatactatgacttgattaagcctactcgctgtttggtggaagaaaaacagcga
tatttgaaaatccagcaggaagatgaaaccgtctatgtagcttactttaccattaacagc
attgtcggagaactggacttcccgtcctctgaaatcttctactaccagcaacagcaattt
acattcccgattgatacgtcaatgaatgtggaaattgtagcgaatcgtaaagccctatct
actgtccgcaataaaaagaaagaactgaaagacttggataaccacgcttggcaaagtgat
aatgaaaccagctccaatgtggcggaagctctggaaagtgtgaatgagctggaaaccaat
ttagaccaaagcaaggaatctatgtacaagctgtcttatgtggtaagggtatcgcaaatg
atcttgacgaactcaaacgtcgttgtaatgaagtga

DBGET integrated database retrieval system