KEGG   Mageeibacillus indolicus: HMPREF0868_1209Help
Entry
HMPREF0868_1209   CDS       T01181                                 

Definition
(GenBank) hypothetical protein
Organism
clo  Mageeibacillus indolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TcpE
Motif
Other DBs
NCBI-ProteinID: ADC90567
UniProt: D3R2T1
Position
542974..543480
Genome map
AA seq 168 aa AA seqDB search
MGFLKSSIKSVGTLLLADFLFYGVAQSATPIFYERIDYMKKIRSYTSIWSVEKVLYSIND
FRLPFPITFTQMTWFVVSLFAVMILGNLPPLSMIEGAFLKYFGIPVAFTWFMSTKTFDGK
KPYGFLKSVIAYALRPKLTYAGKKVTLGRNQPQEAITAVRSEFYGISN
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgggatttttgaaatcgtctattaaatctgtcggtacattactactggcagattttcta
ttttacggggtggctcaatcagctacccctattttttatgaaaggattgattacatgaag
aaaatacgaagctataccagtatctggtctgtggaaaaggtactgtattctatcaatgat
tttagacttccgtttcccataacctttacgcaaatgacatggtttgtcgtgtcactcttt
gcagtgatgatacttggcaacttgccccctctttccatgatagagggagcatttctcaaa
tactttgggattcctgtggctttcacatggtttatgtctacaaaaacttttgatggtaaa
aagccttatggatttttgaagtctgtcattgcttatgcactgcgaccaaagctgacctat
gcaggaaaaaaagtaacgcttggcagaaaccagccacaagaagccattacagcagttagg
agtgaattttatggcatatccaattaa

DBGET integrated database retrieval system