KEGG   Mageeibacillus indolicus: HMPREF0868_1210Help
Entry
HMPREF0868_1210   CDS       T01181                                 

Definition
(GenBank) antirestriction protein ArdA
Organism
clo  Mageeibacillus indolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArdA DUF3201 RhoGAP
Motif
Other DBs
NCBI-ProteinID: ADC91369
UniProt: D3R2T2
Position
542505..542999
Genome map
AA seq 164 aa AA seqDB search
MDDMQVYIANLGKYNEGELVGAWFTFPIDFEEVKEKIGLNDEYEEYAIHDYELPFTVDEY
TSIGELNRLWEMVSELPEELQSELSALLTHFSSIEELSEQEDIIIHSDCDDMYDVARYYI
EETGALGEVPASLQNYIDYQAYGRDLDLSGTFISTNHGIFEIVY
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggacgatatgcaagtctatattgcgaatttaggcaaatacaatgagggcgaattggtc
ggtgcgtggtttacctttcccattgactttgaggaagtcaaagagaaaatcggcttgaat
gatgaatatgaggaatacgccattcatgactacgagttaccctttacggttgacgaatac
acttccattggcgaactcaatcgactatgggaaatggtatcggaattacccgaagaatta
caatcggagctatctgctctgctcactcatttttcaagcattgaagaactaagcgaacaa
gaggatattatcattcattccgattgtgatgatatgtatgacgtggcacgctactacatt
gaagaaacgggtgctttaggcgaagtaccagctagtcttcaaaactatattgattatcaa
gcctatggtcgggatttagacctttcaggaacgtttatctcaaccaatcatgggattttt
gaaatcgtctattaa

DBGET integrated database retrieval system