KEGG   Mageeibacillus indolicus: HMPREF0868_1211Help
Entry
HMPREF0868_1211   CDS       T01181                                 

Definition
(GenBank) hypothetical protein
Organism
clo  Mageeibacillus indolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC DUF3976 Wzy_C
Motif
Other DBs
NCBI-ProteinID: ADC91391
UniProt: D3R2T3
Position
542167..542388
Genome map
AA seq 73 aa AA seqDB search
MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKREFSKLIGFLIIAIIAVGLVFNAAGVK
DILLELFNRIIGA
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgaattttggacaaaacctttataactggtttctatcaaacgctcaatcactggtgctt
ttagcaatcgttgtgattggcttgtatcttggcttcaagcgtgagtttagcaaactgatt
ggctttttaattattgcgattattgcggttggcttagtcttcaacgctgctggagtaaaa
gacattttactagagctattcaatcgcattattggtgcttaa

DBGET integrated database retrieval system