KEGG   Mageeibacillus indolicus: HMPREF0868_1212Help
Entry
HMPREF0868_1212   CDS       T01181                                 

Definition
(GenBank) DNA-binding helix-turn-helix protein
  KO
K07467  phage replication initiation protein
Organism
clo  Mageeibacillus indolicus
Brite
KEGG Orthology (KO) [BR:clo00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    HMPREF0868_1212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rep_trans Rol_Rep_N HTH_3 HTH_31 HTH_19 HTH_25
Motif
Other DBs
NCBI-ProteinID: ADC91495
UniProt: D3R2T4
Position
540919..542124
Genome map
AA seq 401 aa AA seqDB search
MEGFLLNEQTWLQHLKEKRLAYGLSQNRLAVATGITRQYLSDIETGKVKPSEDLQQSLWE
ALERFNPDAPLEMLFDYVRIRFPTTDVQQVVENILQLKLSYFLHEDYGFYSYSEHYALGD
IFVLCSHELDKGVLVELKGRGCRQFESYLLAQQRSWYEFFMDVLVAGGVMKRLDLAINDK
TGILNIPVLTEKCQQEECISVFRSFKSYRSGELVRKEEKECMGNTLYIGSLQSEVYFCIY
EKDYEQYKKNDIPIEDAEVKNRFEIRLKNERAYYAVRDLLVYDNPEHTAFKIINRYIRFV
DKDDSKPRSDWKLNEEWAWFIGNNRERLKLTTKPEPYSFQRTLNWLSHQVAPTLKVAIKL
DEINQTQVVKDILDHAKLTDRHKQILKQQSVKEQDVITTKK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
ttggagggatttttactgaatgaacaaacttggttacagcatttaaaagaaaaacgcttg
gcttatggactatctcaaaaccgtttagctgttgcgactggtattacaaggcagtatcta
agcgatattgaaacaggaaaagtcaagccatcagaggatttacagcagtccctttgggaa
gctctggaacgcttcaatcccgacgctccccttgaaatgctgtttgattatgtaaggatt
cgctttccgacaacagacgtacagcaggtggtcgaaaacatcttacaactgaaactgtcc
tattttcttcatgaggactatggtttctattcttattcagagcattatgctttaggcgac
atattcgtcctttgctcccatgaactggacaaaggagttctggtggaattgaaaggtcgt
gggtgcagacaatttgaaagctatcttctggcacaacaaagaagctggtatgagttcttt
atggacgttttggtggctggcggtgtgatgaaacgccttgaccttgccattaacgataag
acagggattttgaatatccctgtactcactgaaaagtgccaacaggaagaatgtatctcc
gtcttccgcagttttaaaagctatcgcagtggcgaactggtacgcaaagaggaaaaggaa
tgtatgggaaacaccctctatatcggttcattacaaagtgaagtttatttctgtatctat
gaaaaggactacgagcagtacaagaaaaatgatattcccattgaagacgcagaagtaaaa
aaccgttttgagattcgattgaaaaatgagcgtgcctattatgcagtccgtgatttactc
gtctatgacaatccagagcataccgcctttaaaattatcaatcggtatatccgttttgta
gataaagacgattccaaacctcgttctgattggaaactgaatgaagaatgggcttggttt
attgggaacaatcgtgaacgattaaaactaaccacaaaaccagagccttactccttccaa
aggacgctgaactggctatctcatcaagttgccccgaccttaaaggttgcgattaaactt
gatgaaatcaaccagacgcaggttgtaaaagacattctcgaccatgcgaaactgacagac
cgacacaagcagattttgaagcaacagtcagtaaaagaacaggacgtgataacaacaaaa
aaataa

DBGET integrated database retrieval system