KEGG   Mageeibacillus indolicus: HMPREF0868_1213Help
Entry
HMPREF0868_1213   CDS       T01181                                 

Definition
(GenBank) FtsK/SpoIIIE family protein
Organism
clo  Mageeibacillus indolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsK_SpoIIIE DUF87 AAA_10 TrwB_AAD_bind ResIII T2SSE Pox_A32 AAA AAA_19 Calcyon DUF853 AAA_22
Motif
Other DBs
NCBI-ProteinID: ADC90477
UniProt: D3R2T5
Position
539356..540741
Genome map
AA seq 461 aa AA seqDB search
MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPY
LIISFSVAILICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDS
AGRTKEKITYFPKMYYRLKNGLIQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKD
SYVEYTLLYDTIASRISIDEVEAKDGKLRLMKNVWWEYDKLPHMLIAGGTGGGKTYFILT
LIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLLSCIETFYEEMMKRSEEMKQM
KNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLGRQAGFFLILA
CQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSV
ISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcgtggtaaaaggattcgcccatctggtaaagatttagtctttcattttacg
atagcgtcactcctgcctgttttcctgctggttgtcggactgtttcatgtgaagacaatc
cagcagatcaactggcaggattttaacctatcacaagcagataagattgacattccctat
ttaattatcagtttcagtgtcgcaattcttatctgcttgctggtagcgtttgtattcaaa
cgggttcgctatgatacggttaaacaactttaccaccgtcaaaaactggcaaagatgata
cttgaaaacaagtggtatgaatctgaacaggtcaaaacagagggtttctttaaagatagt
gctggtcgtacaaaggaaaagataacctacttccctaaaatgtattatcgacttaaaaat
ggcttgatacagatacgggtggaaatcacgctgggaaaatatcaagaccaactcttacac
ttggaaaagaaattagagagtggcttgtactgtgagctgacggataaagagttaaaggat
tcctatgtggaatatactttgctctatgacaccatagccagtcgtatttctattgatgaa
gtagaagctaaagatggtaaacttcgcttaatgaaaaacgtatggtgggaatatgataag
ctccctcatatgttgattgctggtggtacaggtggcggtaaaacttactttatactgaca
ctgattgaagccttgcttcatacagattcaaaactgtatattcttgacccgaaaaatgct
gaccttgcggacttaggttctgtgatggcaaatgtctactatagaaaagaagacttgctt
tcttgcattgaaacattctatgaagaaatgatgaaacgtagtgaggaaatgaagcagatg
aagaactataagactggcaaaaattatgcttacttaggtctcccggcacacttcttaatc
tttgatgaatacgtcgctttcatggaaatgctgggaacaaaagaaaacaccgcagttatg
aataagctgaaacagattgtcatgttaggtcgtcaagctggcttctttctaatactggct
tgtcaacgtccagacgcaaaatatttaggcgacggaatccgtgatcagtttaatttcaga
gtggctttaggtcgtatgtctgaaatgggctatggcatgatgtttggcagtgacgtacaa
aaggatttcttcttaaagcgaatcaaaggtcgtggctatgttgatgtaggaacaagtgtc
atatcagagttttatactccccttgtaccaaaaggatatgatttcttggaggaaattaaa
aagttatccaacagcagacagtccacgcaggcgacgtgcgaagcggaagtcgcaggtgtg
gactga

DBGET integrated database retrieval system