KEGG   Mageeibacillus indolicus: HMPREF0868_1214Help
Entry
HMPREF0868_1214   CDS       T01181                                 

Definition
(GenBank) hypothetical protein
Organism
clo  Mageeibacillus indolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF961
Motif
Other DBs
NCBI-ProteinID: ADC91314
UniProt: D3R2T6
Position
538941..539327
Genome map
AA seq 128 aa AA seqDB search
MMRLANGIVLDKDTTFGELKFSALRREVRIQNEDGSVSDEIKERTYDLKSKGQGRMIQVS
IPASVPLKEFDYNARVELINPIADTVATATYQGADVDWYIKADDIVLTKDSSSFKAQPQA
KKEPTQDK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgatgagattagcaaatggcattgtattagataaagacacgacttttggagaattgaaa
ttctctgctctacgtcgtgaagtgagaatccaaaatgaagacgggtcggtttcagatgaa
atcaaggaacgtacctatgacttaaaatccaaaggacaaggacgcatgattcaagtaagt
attcctgccagcgtgcctttgaaagagtttgattataacgcacgggtggaacttatcaat
cccattgcggacaccgttgctactgccacctatcaaggagcagatgttgactggtatatc
aaggcagacgatattgtgctgacaaaggattctagttcattcaaagctcaaccacaagca
aagaaagaaccgacacaagacaaatag

DBGET integrated database retrieval system