KEGG   Mageeibacillus indolicus: HMPREF0868_1215Help
Entry
HMPREF0868_1215   CDS       T01181                                 

Definition
(GenBank) hypothetical protein
Organism
clo  Mageeibacillus indolicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF961
Motif
Other DBs
NCBI-ProteinID: ADC91050
UniProt: D3R2T7
Position
538611..538925
Genome map
AA seq 104 aa AA seqDB search
MELKFVIPNMEKTFGNLEFAGEDKVVQRRINGRLTVLSRSYNLYSDVQRADDIVVVLPAE
AGEKHFGFEERVKLVNPRITAEGYKIGTRGFTNYLLHADDMIKE
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atggaacttaaatttgtgattcccaacatggaaaaaacattcggcaatttagaatttgct
ggcgaggataaagtcgttcagcgaagaatcaacggacggctaactgtcttatcaagaagc
tataatctctattctgatgttcaaagagcagatgatattgtggtggtgcttcctgctgaa
gctggcgaaaaacatttcggctttgaggaacgtgtgaagttagtcaatccacgtattacc
gcagagggctacaaaatcggcactcgtggttttacaaattaccttttacatgctgacgac
atgataaaagaataa

DBGET integrated database retrieval system