KEGG   Chlamydia pneumoniae LPCoLN: CPK_ORF00635Help
Entry
CPK_ORF00635      CDS       T01859                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
clp  Chlamydia pneumoniae LPCoLN
Pathway
clp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:clp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CPK_ORF00635
Enzymes [BR:clp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CPK_ORF00635
DNA repair and recombination proteins [BR:clp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CPK_ORF00635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 Viral_helicase1 PIF1 Helicase_RecD AAA_11 PhoH HHH_5 T2SSE AAA_22 UvrD-helicase NTPase_1 RsgA_GTPase AAA_16 AAA_15 ABC_tran Mg_chelatase AAA_23 DEAD ArgK AAA_28 KTI12 AAA_29 DUF2075 TrwB_AAD_bind AAA_18 Thymidylate_kin AAA_12 HHH_2 MMR_HSR1 AAA_5 ATP-synt_ab AAA CPT
Motif
Other DBs
NCBI-ProteinID: ACZ33104
Position
689600..691798
Genome map
AA seq 732 aa AA seqDB search
MEKICGYLEQILVENKDSGDITAYIKIPNKTTPILIKGKLPQPLELGSPIQIYGVWSHSP
SNTKYFQIHSYDSPLLYEYRGVFHYLTSKLIKGIGPKIAEKIIEKFQEKTCYVLDITPER
LSEVSGISETRCVSICKQLCEQKILRKTLLFLQEYNIPIHYGVRIFKKYQEKSIEKICED
PFLLAREMEGIGFKTADFIAMKLGVPRNSESRLCAGIQHSLEELQEEGHTCYPIELLIDV
VAKLLNQDVFDTPITLEEIDTQILNMQKRKLLHIQDISGTLHVWTRYLHLAEKTIVSDLK
RILFSSRRIRSIDGEKAIAWVEENLSIDLAEQQREAIKACFSEKLLIITGGPGTGKSTIT
QAILKIFEQVTHKIILAAPTGKAAKRMTEITQKHSVTIHALLQYDFKTKSFRKNHDNPID
CDLIIVDESGMMDTHLLHHFLKALPDYTTLVFIGDIHQLPSVGPGNILKDLITSNKMTVI
RLNKIFRQVHDSGIVTNAHRVNEGELPILYSETGRRDFLFFQKDDQEEALNHIIHLVTKF
VPQKYHIYPQDIQVLAPMKKGTLGIYNLNKALKHALNPKKANLHGRFQSYAVGDKVMQIR
NNYNKEVFNGDIGYVSTINFEDKAVVVRMEGKHVGYSFSELDDLVLAYATSVHKYQGSES
PCIIIPIHTSHFMMLYRNLLYTAITRGKKLVILVGTKKAIAIATRNNRVQHRCTGLAEVL
KELDTKKNYADL
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatctgcggatacttagagcaaatacttgttgaaaacaaagactctggggac
attactgcttatatcaaaatacccaataaaacgactcctatcctaattaaaggcaaactt
ccccaacctttggaactaggatccccaatccaaatctatggtgtctggagccattcccct
tcaaatactaagtatttccaaatccatagttacgactctcctcttctttatgaatatcgt
ggcgtattccattacctcacctcaaaactcatcaaaggaatcggccctaagatcgcagaa
aagatcatcgagaaatttcaagagaaaacatgttatgtcctcgatatcactccagaacgc
ttaagtgaggtttctggaattagcgaaacacgatgtgtctctatttgcaaacaactctgc
gagcaaaaaatcttaaggaaaactcttctctttctccaagaatacaatatcccgattcat
tatggagtgagaatttttaaaaaataccaagagaaatccatagaaaaaatttgcgaagat
cccttccttctagccagagaaatggagggcatcggattcaaaactgctgatttcatagct
atgaaactaggcgtccccagaaattctgaaagtcgcctatgtgctggtatccagcactcc
ttagaagaacttcaagaagaaggtcatacttgctatccgatagagctcctgatagatgtc
gtagccaaactattaaatcaagatgtctttgatactcctattactctcgaagaaatcgat
acgcaaatcctcaatatgcaaaagcgtaagcttttacatattcaagacatttctgggaca
ctccatgtctggacacgttatctccatctcgcagagaaaactattgtttctgatctcaag
cgcattttattttcttcgaggagaatccgttctatagacggagaaaaagcaattgcttgg
gtagaggaaaacctaagtatagatctcgcagaacaacaacgagaagcaattaaagcctgt
ttttctgaaaaacttctcatcattactgggggccctggaactggaaaaagtaccattacc
caagcaatactgaaaatttttgaacaggtgactcataaaatcatcctcgcagctcctaca
ggaaaagccgctaaacggatgaccgaaattacacaaaaacactcggtcaccattcatgct
ctgctacagtatgattttaaaacgaaatctttccgcaagaaccatgacaatcctatagac
tgtgatctgatcattgttgacgaatccggaatgatggacacgcacttgctgcaccacttc
ctgaaagcacttcctgactacacaactcttgtctttattggagacattcaccagctaccc
agcgtgggcccaggaaatatccttaaagacttgattacttcgaataaaatgacagtcatc
agattaaataagatcttccgccaagttcatgattcgggaatcgttacgaatgcccatagg
gtaaatgaaggggaactccccatattatattcagaaacagggcgtcgtgatttcttattt
ttccaaaaggatgatcaagaagaggctctcaatcatatcattcatcttgtgacaaaattc
gtcccacaaaaataccatatctatcctcaagatatccaagtactagctcccatgaaaaaa
ggaaccctaggaatctataatctaaataaagcactcaaacatgcattaaaccctaaaaaa
gcaaatcttcacggtagatttcaatcctatgccgttggcgataaggtaatgcaaatccgc
aacaactataataaagaagtctttaacggcgatataggctatgtctctacaatcaacttc
gaagataaagctgttgttgtccgtatggaaggaaagcatgtcggctattctttctcagag
cttgacgatctagtcttagcctatgctacctcagtacataagtaccagggaagtgaaagc
ccctgcattatcattcctattcatacctcgcactttatgatgctctatagaaatcttctc
tatactgctattacgcgggggaaaaaattggtgattctagttgggacaaaaaaagccatt
gctattgcaacaagaaataatcgagtgcaacaccgatgtacaggactagcagaagttctt
aaagagctcgatactaagaaaaattatgcagatctgtaa

DBGET integrated database retrieval system