KEGG   Chlamydia pneumoniae LPCoLN: CPK_ORF00814Help
Entry
CPK_ORF00814      CDS       T01859                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
clp  Chlamydia pneumoniae LPCoLN
Pathway
clp00010  Glycolysis / Gluconeogenesis
clp00020  Citrate cycle (TCA cycle)
clp00620  Pyruvate metabolism
clp01100  Metabolic pathways
clp01110  Biosynthesis of secondary metabolites
clp01120  Microbial metabolism in diverse environments
clp01130  Biosynthesis of antibiotics
clp01200  Carbon metabolism
Module
clp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:clp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPK_ORF00814 (pdhC)
   00020 Citrate cycle (TCA cycle)
    CPK_ORF00814 (pdhC)
   00620 Pyruvate metabolism
    CPK_ORF00814 (pdhC)
Enzymes [BR:clp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CPK_ORF00814 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACZ33281
Position
complement(496731..498020)
Genome map
AA seq 429 aa AA seqDB search
MISLLKMPKLSPTMEVGTIVKWHKKSNDQVSFGDVIVEISTDKAILEHTANEDGWIREIL
RHEGEKIVIGTPIAVLSTEANEPFNLEELLPKTEPSNLEASPKGSSEEVSPATTPQAASA
TFTAVTFKPEPPLSSPLVFKHVGTTNNLSPLARQLAKEKNIDVSSIQGSGPGGRIVKKDL
EKAPPKSIAGFGYPESPEVPPGSYHEENLSPIREVIAARLQAAKISIPHFYVRQQVYASP
LLNLLKELQAQGIKLSINDCIVRACALALKEFPSINSGFNSVDNKIVRFDTIDISIAVAI
PDGIITPIIRCADRKNLGMISAEIKSLALKARNQSLQDTEYKGGSFCVSNLGMTGITEFT
AIVNPPQAAILAVGSVTEQALVLDGEITIGSTCNLTLSVDHRVIDGYPAAMFMKRLQKIL
EAPAVLLLN
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgatctccttattgaaaatgccaaagctttctccaactatggaagtgggcactatagtg
aaatggcataaaaaaagtaatgatcaggtcagttttggagacgtcattgtagagatctct
acagacaaagctattttagaacatacagcaaatgaagatggctggattcgtgaaatctta
cgtcatgaaggcgagaaaatcgttataggcacccctattgcggtactctctacagaagcc
aacgagccctttaatctagaagaacttcttcctaagacagaaccttctaaccttgaagca
tctccaaaaggttcttctgaagaggtctcgcctgcaacaactccacaagctgcctcagca
acattcacagcagtaacttttaagccagagccacctctctcctcgcctttagtcttcaaa
cacgtaggcactacgaataatctctctccattagctagacaactagcaaaagagaaaaac
atagatgtctcatcaattcaagggagtggtcctggaggacgtatagtaaaaaaagattta
gagaaagctcctcctaaaagcattgctggttttggctatcctgagtctcccgaagtgcct
ccaggttcctatcatgaggagaatctctctccgattcgggaagtgattgctgcacgccta
caagctgctaagatctctattcctcacttctatgtaaggcagcaggtctacgcctcacct
ctccttaatctgctcaaagaacttcaagctcagggaatcaaactctctattaacgattgc
attgtacgtgcctgtgctctggcgctcaaagagttcccttctatcaattcaggatttaac
agtgtcgataataaaatcgtccgttttgacactatcgatatctcgatagctgtggccatt
ccagatggaattattacgccaattatacgctgcgcagaccgtaaaaatctcggcatgatt
tcagcagaaattaagagcttagcgttaaaagcaagaaatcaatctcttcaagacactgaa
tacaaaggagggtccttctgtgtctctaacttaggaatgacaggaatcactgaatttaca
gcgattgtcaatcctcctcaagcggcgattcttgccgtaggaagtgttacagaacaagct
cttgttcttgacggagaaattactataggatctacctgcaatcttaccctatctgtagat
catagagtgattgatggttatcctgctgcgatgtttatgaaacgattacaaaagatctta
gaagctccggctgtcctactattaaactag

DBGET integrated database retrieval system