KEGG   Campylobacter lari RM16701: UPTC16701_0273Help
Entry
UPTC16701_0273    CDS       T03550                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
clr  Campylobacter lari RM16701
Pathway
clr00471  D-Glutamine and D-glutamate metabolism
clr00550  Peptidoglycan biosynthesis
clr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    UPTC16701_0273 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    UPTC16701_0273 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:clr01011]
    UPTC16701_0273 (murD)
Enzymes [BR:clr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     UPTC16701_0273 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:clr01011]
 Precursor biosynthesis
  Amino acid ligase
   UPTC16701_0273 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C DUF3445
Motif
Other DBs
NCBI-ProteinID: AJD04343
Position
complement(238975..240174)
Genome map
AA seq 399 aa AA seqDB search
MKISLFGYGKTTKAFVQRFGNCDIYDDHFTSISKDEFGNTLLPPCKFDPLKSDLEIPSPG
FPSDHLLIQQARNLSSEYDFFYDGMPKSVWISGTNGKTTTTQMTHHLLKHINAQMGANIG
TPLAQMDANAKLWILESSSFSLFYTKIAKPEIYALLPITPDHLSWHKSFENYEQAKLSVL
ERMNENDVVILPKKYEAYPTHAYVVSYEDEQDLAKKMQIDLEKIHFKTPFLLDALIALSI
EKIILDRCSYELLNEFKIEKNKLEEIFDHKNRLWVNDTKATNLDASLAALKRYKDKKIHL
IIGGDDKGVDLSALFTFMKELDIELYAIGKSTNKMLEYAKNANLKAHYCEFLPKAVEKIN
QNLTNDEVALLSPACASLDQFKSYEERGELFKKCIQELN
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttcactttttggatacggaaaaacaacaaaagcttttgtgcagcgttttgga
aattgcgatatttatgatgatcattttacaagtataagtaaagatgaatttggcaataca
cttttaccaccttgtaaatttgatcctttaaaaagtgacttagaaattccaagccctggc
tttccaagtgatcatcttctcatacaacaagcaagaaatttaagcagcgagtatgatttt
ttttacgatggcatgccaaaaagtgtttggataagcggaacaaatggcaaaaccaccacc
actcaaatgacgcatcatcttttaaaacacattaacgcacaaatgggagcaaacatagga
acccctttagcgcaaatggacgctaatgccaaattatggattttagaaagctcatctttt
tcacttttttacactaaaatagctaaacctgaaatttatgcacttttacctatcacacct
gatcatctttcttggcataaaagttttgaaaattacgagcaagcaaagcttagcgtgctt
gaaagaatgaatgaaaatgatgtggtaattttacctaaaaagtatgaggcttatccaact
catgcttatgttgtaagctatgaagatgagcaagatttagctaaaaaaatgcaaattgac
ttagaaaaaattcattttaaaaccccatttttacttgatgcacttattgctttaagtata
gaaaaaatcatactagatcgttgctcttatgaacttttaaatgagtttaagatagaaaaa
aacaagcttgaagaaatatttgatcataaaaatagactttgggtaaatgatactaaagca
actaatcttgatgctagtttagctgctcttaaacgctataaggataaaaaaattcatctt
atcataggtggggatgataagggagtggatttaagtgctttattcacttttatgaaagag
cttgatatagaactttatgccataggaaaaagtactaacaaaatgcttgaatatgctaaa
aatgccaatttaaaagcacattattgtgagtttttacctaaagcagtagaaaaaatcaat
caaaacttaactaatgatgaagtagccctgctaagccctgcttgtgcgagtttagatcag
tttaaatcttatgaagaaagaggggagctttttaaaaaatgtattcaagagctaaactaa

DBGET integrated database retrieval system