KEGG   Campylobacter lari RM16701: UPTC16701_0357Help
Entry
UPTC16701_0357    CDS       T03550                                 

Gene name
selD
Definition
(GenBank) selenophosphate synthetase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
clr  Campylobacter lari RM16701
Pathway
clr00450  Selenocompound metabolism
clr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    UPTC16701_0357 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:clr03016]
    UPTC16701_0357 (selD)
Enzymes [BR:clr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     UPTC16701_0357 (selD)
Transfer RNA biogenesis [BR:clr03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    UPTC16701_0357 (selD)
 Prokaryotic type
    UPTC16701_0357 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS DUF2520 DisA_N
Motif
Other DBs
NCBI-ProteinID: AJD04425
Position
327037..327999
Genome map
AA seq 320 aa AA seqDB search
MGLDKILGILKPHENILSGINNNEDASVYKLNEDLALVQTLDFITPVVDSAYHFGAIAAA
NALSDVFAMGAEVINALNIVGFDTCHFNNEILLEVLEGARVKVEEAGAVLVGGHTIENDE
FIFGLSVTGVVHPKKFIANNSAKDGDVILLTKPIGSGIISTAIKAGLLEKAKILKAVEQM
SFLNLYASRILKSFKSLSALSDVTGFGLLGHLKEMLNKEIMIEVYKNEIPLMDGVLSMAN
MGIIPAGAYKNKDSLKIWVENLNEKDEDIVYFDPQTSGGLLAGMSENEASEALKILKEYN
IEAKIIARCVKNTHNYLLLR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgggtcttgacaaaattcttggcattttaaaaccgcatgaaaacattttaagtggtatt
aataataatgaagatgcgagtgtttataagctaaatgaagatttagctttggtgcaaact
cttgattttattacacccgtggttgatagtgcgtatcattttggcgctatagctgctgca
aatgctttaagtgatgtatttgctatgggtgctgaggtgattaatgctttaaatattgta
ggttttgatacttgtcattttaataatgaaattttgcttgaagtgttagaaggtgctaga
gttaaggttgaagaagctggcgctgtgctagtaggtgggcatactatagaaaatgatgaa
tttatttttgggcttagtgtaacaggagtagttcatcctaagaaatttatagctaataat
agcgcaaaagatggtgatgtaattttacttactaagcctataggcagtggtattattagt
actgctatcaaggctggtttgctagaaaaagcaaagattttaaaagcagtagagcaaatg
agttttttaaatttatatgcaagtcgtattttaaagagctttaaaagtcttagtgcttta
agtgatgtgacaggttttggtcttttaggacatttaaaagaaatgttaaataaagagatt
atgatagaagtatataaaaatgaaattcctttaatggatggagttttgtcgatggctaat
atggggataatcccagctggagcttataaaaataaagatagcctaaaaatttgggttgaa
aatttaaatgaaaaagatgaggatatagtgtattttgatcctcaaacttcaggtggactt
ttagctggtatgagtgaaaatgaagcaagtgaagctttaaaaatacttaaagaatataat
attgaagcaaagattatcgctagatgtgtaaaaaatactcataattatttattattacgc
taa

DBGET integrated database retrieval system