KEGG   Campylobacter lari RM16701: UPTC16701_1304Help
Entry
UPTC16701_1304    CDS       T03550                                 

Gene name
ndk
Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
clr  Campylobacter lari RM16701
Pathway
clr00230  Purine metabolism
clr00240  Pyrimidine metabolism
clr01100  Metabolic pathways
clr01110  Biosynthesis of secondary metabolites
clr01130  Biosynthesis of antibiotics
Module
clr_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
clr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
clr_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:clr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    UPTC16701_1304 (ndk)
   00240 Pyrimidine metabolism
    UPTC16701_1304 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:clr04131]
    UPTC16701_1304 (ndk)
Enzymes [BR:clr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     UPTC16701_1304 (ndk)
Membrane trafficking [BR:clr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    UPTC16701_1304 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AJD05331
Position
1281206..1281619
Genome map
AA seq 137 aa AA seqDB search
MEKTLSIIKPDAVKKGVIGQILTRFESNGLRIAATKKMQLSEKEAQEFYAVHKDRPFFKD
LVEFMISGPVVVSVLEGENAVLKNRELMGATNPKEAAPGTIRADFADSIDANAVHGSDSL
ENAKIEIEFFFSKTEIL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaacactttctattattaaacctgatgcagttaaaaaaggtgttattggtcaa
attttaacacgctttgaaagcaatggtctaagaatagcagcaacaaaaaaaatgcagctt
tcagaaaaagaagctcaagaattttatgctgtacacaaagacagaccttttttcaaagat
ttagttgaatttatgatcagtggtccagttgtggtttctgttttagaaggcgaaaatgct
gtattaaaaaacagagaattaatgggtgctacaaatccaaaagaagcagctcctggtact
attagagcagattttgcagatagtattgatgcaaatgcggttcatggaagcgatagcttg
gaaaatgcaaaaattgaaatagaatttttcttttcaaaaactgaaattttataa

DBGET integrated database retrieval system