KEGG   Clostridium sp. SY8519: CXIVA_05020Help
Entry
CXIVA_05020       CDS       T01565                                 

Definition
(GenBank) hypothetical protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
cls  Clostridium sp. SY8519
Brite
KEGG Orthology (KO) [BR:cls00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CXIVA_05020
Enzymes [BR:cls01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     CXIVA_05020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: BAK46469
UniProt: F7V8K9
Position
complement(527421..528257)
Genome map
AA seq 278 aa AA seqDB search
MEKFKAAVCQMDTQDSVSENLEQAGLLLDAVCAQGVQLAVFPENVNYIGENSRAHAESIP
GETSRFFCQEAVKRQIWILAGSLAERSDSGKPKNTSLLVDPRGRIAARYSKLHPFDVTLS
DGLAWKESDTRTVGDEVVLADTRDLGCLGFSICYDLRFPELYRLLALKGAKIILVPANFT
KNTGKDHWEVLLRARAIENGVYVIAADQWGKKPDMTSYGHSMIIDPWGNILAEVGEGVGF
AVAEIDPDRVARVRGQIPSLKNRREDIYHLDSSRIRRF
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggagaaattcaaggcggctgtctgccagatggatacgcaggacagcgtcagtgagaat
ctggaacaggccggtctgctgctggacgcggtgtgcgcacagggggttcagctggctgtg
tttccggaaaatgtgaactatatcggtgaaaacagccgggcccatgcggaaagcataccg
ggagagacttcgcggtttttctgtcaggaagccgtcaaaagacagatctggatcctggcc
ggcagcctggcggaacgcagtgacagcggcaaaccgaaaaacacttcgctgctggttgat
cccaggggaaggatcgcggcccggtacagcaagctgcatccttttgatgtgacgttaagt
gacggacttgcctggaaagagtccgacaccagaacggtgggagacgaggtggtgctggca
gataccagagatctcggctgtctggggttttccatctgctatgacctgcgttttccggaa
ctgtaccggctgcttgcgctcaaaggcgccaaaatcattctggtaccggccaattttacc
aaaaacacaggcaaggaccactgggaagtcctgctgcgggcaagagcgattgagaacggc
gtctatgtgatcgcagcggatcagtgggggaaaaaaccggatatgacatcctacgggcat
tctatgatcattgatccctggggaaacatcctggcggaagtgggggaaggggtaggattt
gccgtggcagagattgatcccgaccgggtggcgcgggtgcgtggacagattccttctctg
aaaaaccgcagagaagatatttatcatctggacagcagccggatccggcgtttttag

DBGET integrated database retrieval system