KEGG   Clostridium sp. SY8519: CXIVA_12030Help
Entry
CXIVA_12030       CDS       T01565                                 

Gene name
RluA
Definition
(GenBank) pseudouridylate synthase, 23S RNA-specific
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
cls  Clostridium sp. SY8519
Brite
KEGG Orthology (KO) [BR:cls00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cls03009]
    CXIVA_12030 (RluA)
Enzymes [BR:cls01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     CXIVA_12030 (RluA)
Ribosome biogenesis [BR:cls03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CXIVA_12030 (RluA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: BAK47169
UniProt: F7V340
Position
complement(1297167..1298075)
Genome map
AA seq 302 aa AA seqDB search
MERIFTYTIPAEADGMDTAAFLLSRSYTRQILIGLKKDERGITVNGAHAGVRRILHTGDV
LQTVFSEEASPGVRPVSLPCRILYEDEDLLLADKPADMPVHPSVNNHDNTLANALAWHYQ
QAGIPFTFRCITRLDRDTTGLVLLAKNRLAASILNRAHATIQKTYLAICQGRIPCAGVID
APIARVQGSVIARCVDFARGDRALTRYSRLFYDPEKDLSLAHLIPDTGRTHQIRVHMRHI
GHPLIGDFLYNPGNTALGRQALHCFGLDFVHPITRQKLHLSSPLPEDMRGCLAAVPAPFS
GR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcatctttacttacacgatccccgcggaagcagacggaatggacactgctgcc
ttcctgctgtcccgcagctatacccggcagattctcatcggactcaagaaagatgagcgg
ggcattaccgtcaacggcgcccacgccggtgtccggaggattctgcataccggagatgtg
ctgcagacggtattttcggaagaagcctctccgggcgtccgtccggtgtctcttccctgc
cgcatcctctatgaagacgaggatctgctgctggcagacaagcccgccgatatgccggtt
cacccttctgtcaacaaccatgacaacaccctggccaacgcgttggcttggcactatcag
caggccggcattccctttaccttccgctgcatcacccggctggaccgggataccaccgga
ctggtgctccttgccaaaaacaggctggccgcttccatcctgaaccgtgcccacgcaact
atacaaaaaacctatctggcgatctgtcagggacggatcccctgcgccggtgtcatagat
gctcccatcgcccgggtacaggggtctgtgattgcccgctgtgttgactttgcccgggga
gaccgggcgctgacccgctactcccggctcttctatgatccggaaaaggacctgtccctg
gcacacctgatcccggacaccggcagaacccaccagatccgcgtccacatgcgccatatc
gggcatccgctgatcggcgattttctctacaatccgggaaataccgccctgggccgccag
gcgctccactgcttcggcctggactttgtccatccgatcacccgtcaaaaactgcacctt
tcttccccgctgcccgaagatatgcgcggctgtcttgccgcagttcccgctccgttctcc
ggccgctga

DBGET integrated database retrieval system