KEGG   Clostridium sp. SY8519: CXIVA_15740Help
Entry
CXIVA_15740       CDS       T01565                                 

Definition
(GenBank) hypothetical protein
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
cls  Clostridium sp. SY8519
Pathway
cls00473  D-Alanine metabolism
cls01100  Metabolic pathways
cls01503  Cationic antimicrobial peptide (CAMP) resistance
cls02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cls00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CXIVA_15740
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CXIVA_15740
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    CXIVA_15740
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:cls01504]
    CXIVA_15740
Enzymes [BR:cls01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     CXIVA_15740
Antimicrobial resistance genes [BR:cls01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    CXIVA_15740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAK47540
UniProt: F7V461
Position
complement(1701122..1702627)
Genome map
AA seq 501 aa AA seqDB search
MNILARIEQTAREHGDRLAFHSRFGEITYRDLWERSGRMAAWIQLLQDDCRKPIVVYGHK
SPYMLVSFLACVRSGRAYCPVDISMPPDRVRQIIEAADNDLVIATEPLELEDRLLISERK
LHDVCQYSQTIDSSFQCSGTDIFYIIFTSGSTGNPKGVQISTDNLNHYLEWSVTLPARSE
GNTFLNQAPYSFDLSVMDTYTALASGGTIWATDKPLQQNTRELMPYLADSHINCWVSTPS
FAAMCLADPEFNGSLLPDLHTFLFCGETLTAYTAEQLMIRFPQAKVINSYGPTEATVAVS
AVEITEQMVKSGLSLPIGYPQPGIKALIRREDGSEAKPGETGEIILAGTTVSPGYFQDPE
RTAAAFTKTDVNGTLLPAYHTGDAGWLAEDGLLYYEGRIDLQVKYHGYRIELGDIESNLM
QITGIHKAVVVPKWEDSAIRHLAAFVVAPEYEGNYADRKWIREKLKERIPAYMVPKKIIF
TNDIPMTNNGKADRKSLEQSV
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaatattctagcacgaattgaacagaccgcccgggaacacggggaccggctggcattt
cactcccgtttcggtgaaatcacctaccgggatctctgggaacgctccggccggatggct
gcctggatccagctgcttcaggatgactgccgcaaaccgattgtcgtatacggccataag
agtccgtacatgctggtcagttttctggcctgtgtccggtccggcagagcctattgtccg
gtagacatttccatgccgccggatcgggtccgccagatcattgaagctgcagacaacgat
ctggtcatcgccaccgaacccctggaactggaggatcgtctgctgatctccgaacggaag
ctccacgatgtctgccagtacagccagaccatcgactcgagctttcagtgcagcggcacg
gatatcttctatattatatttacctcaggcagcaccggaaatccaaaaggcgtgcagatt
tccacggacaatctgaaccactacctggaatggtcagtcactctgcccgcgcgttccgaa
ggaaacacttttctgaatcaggcgccttactccttcgacctttcggtcatggatacttac
acggcgctggcttccggcggaaccatatgggccacagacaaaccgctccagcagaatacc
agagaactgatgccctatctggcggactcccatatcaactgctgggtatccaccccctct
ttcgccgccatgtgtctggcagacccggaattcaacggcagtcttctgccggatctgcac
accttccttttctgcggcgagacactgaccgcctataccgcggagcagctgatgattcgc
ttcccacaggcgaaagtcatcaattcctacggcccgaccgaagccaccgtggccgtgtcc
gcagtggaaatcacggaacagatggtaaaatccggcctttccctgcccatcggatacccg
cagccggggatcaaagccctgatccggcgggaagacggcagcgaagccaaaccgggagaa
acgggggaaatcatcctggctggcaccacggtaagccccggatactttcaggatccggaa
cgaaccgcagcggcttttacgaaaacagatgtaaatggaacactgcttccggcgtaccat
accggtgatgccggatggcttgcggaggacggactcctctattatgaaggacgcatcgac
ctgcaggtcaaatatcacggataccgcattgaactgggcgatatcgaaagcaatctgatg
cagatcaccggcatccacaaggccgtcgttgtgccgaagtgggaagattccgccatccgc
cacctggccgcctttgtggtagcgccggaatatgagggaaactatgcagaccgcaagtgg
atccgtgaaaagctgaaagaacggatcccggcctatatggttccgaaaaaaatcatcttt
acaaacgatatccctatgactaataacggaaaggcagaccgcaagagtctggagcagagc
gtataa

DBGET integrated database retrieval system