KEGG   Clostridium sp. SY8519: CXIVA_16790Help
Entry
CXIVA_16790       CDS       T01565                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cls  Clostridium sp. SY8519
Pathway
cls00071  Fatty acid degradation
cls00280  Valine, leucine and isoleucine degradation
cls00310  Lysine degradation
cls00362  Benzoate degradation
cls00620  Pyruvate metabolism
cls00630  Glyoxylate and dicarboxylate metabolism
cls00640  Propanoate metabolism
cls00650  Butanoate metabolism
cls00900  Terpenoid backbone biosynthesis
cls01100  Metabolic pathways
cls01110  Biosynthesis of secondary metabolites
cls01120  Microbial metabolism in diverse environments
cls01130  Biosynthesis of antibiotics
cls01200  Carbon metabolism
cls01212  Fatty acid metabolism
cls02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CXIVA_16790
   00630 Glyoxylate and dicarboxylate metabolism
    CXIVA_16790
   00640 Propanoate metabolism
    CXIVA_16790
   00650 Butanoate metabolism
    CXIVA_16790
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CXIVA_16790
   00072 Synthesis and degradation of ketone bodies
    CXIVA_16790
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CXIVA_16790
   00310 Lysine degradation
    CXIVA_16790
   00380 Tryptophan metabolism
    CXIVA_16790
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CXIVA_16790
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CXIVA_16790
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CXIVA_16790
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cls04147]
    CXIVA_16790
Enzymes [BR:cls01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CXIVA_16790
Exosome [BR:cls04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CXIVA_16790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF1153
Motif
Other DBs
NCBI-ProteinID: BAK47645
UniProt: F7V4G6
Position
1820640..1821827
Genome map
AA seq 395 aa AA seqDB search
MANKVVLAGACRTAIGKMGGQFGNTPAVELGSVVIKEAVNRAGIKPTDVDEVMMGCVIQA
TLGQNPARQASVKAGIPVETPAFTLNVVCGSGLKCVNEAANMIMAGQADVVVAGGMESMS
MAPFALPKARFGYRMFNNTLVDCMVNDALWDAFNNYHMMITAENICDQWKLTREELDEFA
AASQQKAVAAQENGAFKDEIVPVPVKKKKETVMVDTDEGPRPGTTAESLSKLKCCSGKEG
GLVTAGNASGINDGAAAVVLMSEEKAKELGVKPMATFVAGALAGCDPKIMGIGPVPATKK
ALKIAGLTMDDLGLYEANEAFAAQSVAVGKELGFDPAKLNVNGGAIALGHPVGASGCRIL
VTLLHAMAKRPEVKYGLATLCIGGGMGCATIVERA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacaaagttgtattagcaggcgcatgccgtactgctatcggtaaaatgggtgga
cagtttggtaatactccggcagtagagctgggatctgttgttatcaaagaagcagtgaac
cgcgccggcatcaaacctaccgatgtagatgaggtaatgatgggctgtgttatccaggct
accctgggacagaacccggcacgtcaggcgtccgtaaaagccggtatcccggttgagaca
cctgcatttaccctgaatgtagtttgcggttccggtctgaaatgtgtgaacgaagcagcc
aacatgatcatggctggccaggcagacgtagttgttgcaggcggtatggagagcatgtcc
atggcacctttcgcactgccgaaagcacgtttcggatacagaatgttcaacaatacctta
gttgactgcatggttaacgatgcactgtgggatgcatttaacaactatcatatgatgatt
accgcagagaatatctgcgatcagtggaaactgacccgtgaggaactggatgagttcgca
gcagcttctcagcagaaagcagtagcagctcaggagaacggcgcattcaaagatgagatc
gttccggttccggttaagaagaaaaaagaaaccgttatggtagataccgatgagggacct
cgtccgggcacaaccgcagaaagcctcagcaagttaaaatgctgctccggcaaagaaggc
ggactggttacagcaggtaacgcttccggtatcaacgacggcgctgctgcagtcgttctg
atgagcgaagagaaagcaaaagagctcggcgtaaaaccgatggctactttcgtagcaggc
gcactggctggctgcgatcctaagatcatgggtatcggacctgttccggctaccaagaaa
gcattaaagatcgccggccttacaatggatgacctgggactgtatgaagcaaacgaagca
ttcgctgctcagtctgttgcagtaggcaaagagcttggctttgaccctgcaaaattaaac
gtaaacggcggcgcaatcgcgctcggacatccggttggagcttccggatgccgtatcctt
gtaacactgctgcatgcgatggctaagagaccggaagtaaaatacggtctggctactctg
tgcatcggcggcggcatgggctgcgctaccatcgtagaaagagcataa

DBGET integrated database retrieval system