KEGG   Clostridium sp. SY8519: CXIVA_20450Help
Entry
CXIVA_20450       CDS       T01565                                 

Definition
(GenBank) pyruvate:ferredoxin oxidoreductase
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
cls  Clostridium sp. SY8519
Pathway
cls00010  Glycolysis / Gluconeogenesis
cls00020  Citrate cycle (TCA cycle)
cls00620  Pyruvate metabolism
cls00640  Propanoate metabolism
cls00650  Butanoate metabolism
cls00680  Methane metabolism
cls01100  Metabolic pathways
cls01120  Microbial metabolism in diverse environments
cls01130  Biosynthesis of antibiotics
cls01200  Carbon metabolism
Module
cls_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CXIVA_20450
   00020 Citrate cycle (TCA cycle)
    CXIVA_20450
   00620 Pyruvate metabolism
    CXIVA_20450
   00640 Propanoate metabolism
    CXIVA_20450
   00650 Butanoate metabolism
    CXIVA_20450
  Energy metabolism
   00680 Methane metabolism
    CXIVA_20450
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CXIVA_20450
Enzymes [BR:cls01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CXIVA_20450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_16 Fer4_7 Fer4_9 Fer4_2 Fer4_6 Fer4_10 Fer4_17 Fer4_3 Fer4_8 Fer4_18 Fer4_4
Motif
Other DBs
NCBI-ProteinID: BAK48012
UniProt: F7V5I3
Position
2207275..2207580
Genome map
AA seq 101 aa AA seqDB search
MRTDISKISKQTPHTGLTEGLMVFNGGTAKEFRTGEWRNNTPIWKAEQCKQCLLCTPCCP
DGSIPVVNGKRRDFDFYHCKGCGICAQVCPFDAIEMKEGVE
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgagaacggatatttcaaaaatcagcaaacagacgccccataccggactgaccgagggg
ctgatggtattcaatggcggaaccgcaaaagaattccggaccggagaatggagaaataat
acaccgatatggaaggcagagcagtgcaaacagtgtctgctctgtacgccctgctgcccg
gacggcagcattccggtggtcaatggaaaacggagagactttgatttctatcactgcaaa
ggatgcggcatctgcgcccaggtatgtccgtttgacgcaattgaaatgaaggagggtgtg
gagtaa

DBGET integrated database retrieval system