KEGG   Clostridium sp. SY8519: CXIVA_22060Help
Entry
CXIVA_22060       CDS       T01565                                 

Definition
(GenBank) chloride channel protein EriC
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cls  Clostridium sp. SY8519
Pathway
cls00260  Glycine, serine and threonine metabolism
cls00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cls01100  Metabolic pathways
cls01110  Biosynthesis of secondary metabolites
cls01130  Biosynthesis of antibiotics
cls01230  Biosynthesis of amino acids
Module
cls_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cls00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CXIVA_22060
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CXIVA_22060
Enzymes [BR:cls01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CXIVA_22060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: BAK48173
UniProt: F7V5Z4
Position
2410689..2411474
Genome map
AA seq 261 aa AA seqDB search
MNRIEEKFQQLKKEQKKAFVTYITAGLPDMERCKELIKAQEEAGLDVLELGVPFSDPVAD
GPVIQDASFRSIQKGTSLRKCFDLVEKVRKEGVELPIVFMMYYNTITHYGLEEFARKCNE
TGVDGLLVPDLPMEEQGPLKEVLGDRDETILLQLVSPVSAGRIPEILQDARGFVYCVSSM
GVTGQAADFHKSVLSYLKDVKQQSSIPVLMGFGIRTPQDVAPMKEIIDGAIVGSHFINLM
EQNNYDLDTARNYIREFKAGF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaattgaagaaaaatttcagcagctgaaaaaggagcagaagaaagcgttcgtt
acctatattactgcaggacttccggatatggaacgctgcaaagaactgatcaaagcccag
gaagaggcgggactggatgtgctggaactgggcgttcctttttccgatccggttgctgac
ggacctgtgatccaggatgcttctttccggtccatccagaagggcacctctttgcgaaag
tgttttgatctggtggaaaaagtcagaaaagagggcgtggaactcccgattgttttcatg
atgtactataacaccataacacactacggtctggaggaatttgccagaaagtgcaatgag
acaggcgtggacggactgctggttccggatcttccgatggaagagcagggaccgttaaag
gaagtgctgggagaccgggacgaaacgattttgctgcagctggtttccccggtttccgcg
gggcggattccggagattcttcaggatgcccggggatttgtttactgtgtgtcttccatg
ggagttaccggtcaggcagcagatttccacaaatccgttctgtcctatctgaaggacgta
aagcagcagtcttcgattccggtgttaatgggattcggaatccggacgccgcaggatgtg
gcaccaatgaaagagatcatcgacggcgcgattgtcggttctcactttatcaatctgatg
gaacagaacaattacgacctggataccgcacggaattatatccgggaatttaaggcggga
ttctga

DBGET integrated database retrieval system