KEGG   Clostridium bornimense: CM240_2289Help
Entry
CM240_2289        CDS       T03165                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
clt  Clostridium bornimense
Pathway
clt00071  Fatty acid degradation
clt00280  Valine, leucine and isoleucine degradation
clt00310  Lysine degradation
clt00362  Benzoate degradation
clt00380  Tryptophan metabolism
clt00620  Pyruvate metabolism
clt00630  Glyoxylate and dicarboxylate metabolism
clt00640  Propanoate metabolism
clt00650  Butanoate metabolism
clt00900  Terpenoid backbone biosynthesis
clt01100  Metabolic pathways
clt01110  Biosynthesis of secondary metabolites
clt01120  Microbial metabolism in diverse environments
clt01130  Biosynthesis of antibiotics
clt01200  Carbon metabolism
clt01212  Fatty acid metabolism
clt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:clt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CM240_2289 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    CM240_2289 (thlA)
   00640 Propanoate metabolism
    CM240_2289 (thlA)
   00650 Butanoate metabolism
    CM240_2289 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CM240_2289 (thlA)
   00072 Synthesis and degradation of ketone bodies
    CM240_2289 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CM240_2289 (thlA)
   00310 Lysine degradation
    CM240_2289 (thlA)
   00380 Tryptophan metabolism
    CM240_2289 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CM240_2289 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CM240_2289 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CM240_2289 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:clt04147]
    CM240_2289 (thlA)
Enzymes [BR:clt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CM240_2289 (thlA)
Exosome [BR:clt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CM240_2289 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CDM69426
UniProt: W6RXQ2
Position
rep1:complement(2498836..2500017)
Genome map
AA seq 393 aa AA seqDB search
MRDVVICSAVRTAIGSFGGTLKDVPAVDLGAAVIKEALNRANISGEVIDEVIMGNVITAG
LGQNPARQAAVKAGLPIEVSAMTINKVCGSGLRAVSLAYQMIQSGEADAVVAGGMENMSA
APYVVPNARWGARMGDATMKDSMINDALWDAFNQYHMGITAENIAEQWGLTREMQDEFAV
NSQMKAEKAIKEGKFEDEIVPITIPQRKGDPIVFKQDEFPRFGTTIDKLAKLRPSFKKDG
TVTAGNASGINDGAAALVVMSAEKAEALGIKPLAKITSWGSKGVDPKIMGYGPFAATKVA
LERAGLTIGDMDLIEANEAFAAQSLAVAKDLEFNMDIVNVNGGAIALGHPVGASGARILV
TLLHEMKKRDSKRGLATLCIGGGMGTSVIVERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagggatgtcgttatatgtagtgctgtaagaactgccataggtagttttggtggtact
ttaaaagacgtaccagctgttgatcttggagcagctgtaatcaaagaagctttaaataga
gcaaatatcagtggagaagttatagatgaagttataatgggtaatgttattactgcagga
cttggtcaaaacccagcaagacaagcagcagttaaagcaggacttccaatagaagtgtca
gctatgacaataaataaagtttgtggatctggacttagagcagtatctttagcatatcaa
atgattcaatcaggtgaagctgatgcagtcgttgctggaggtatggaaaacatgtctgca
gctccatatgtagtacctaatgctagatggggtgcaagaatgggcgatgcaactatgaag
gattctatgattaatgatgcattgtgggatgccttcaatcaatatcatatgggtataaca
gcagaaaatattgcagaacaatggggattaacaagagaaatgcaagatgagtttgctgta
aattctcaaatgaaagcagaaaaggcaattaaagaaggtaaatttgaagatgaaatagtg
ccaataactattcctcaaagaaaaggagacccgattgtatttaaacaagacgagttccca
agattcggtactactattgataaattagcaaaattaagaccatcattcaagaaagatgga
acagttactgcaggaaatgcttcaggtatcaatgatggagcagcagcattagttgttatg
agtgcagaaaaagctgaagcattaggaattaaaccattagcaaagatcacttcatgggga
tcaaaaggggtagatcctaagataatgggatatggaccatttgcagcaactaaagttgct
cttgaaagagctggattaactataggtgatatggatcttatagaagctaacgaagctttt
gcagctcaaagtttagcagttgctaaagatttagaatttaatatggatatagtaaatgta
aatggtggagctattgcacttggacatccagtaggagcatcaggagcaagaattttagta
actcttcttcatgaaatgaagaaaagagattcaaagagaggattagcaactctttgtatc
ggtggtggaatgggtacatcagtaatagtagaaagattataa

DBGET integrated database retrieval system