KEGG   Clostridium bornimense: CM240_2447Help
Entry
CM240_2447        CDS       T03165                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
clt  Clostridium bornimense
Pathway
clt03010  Ribosome
Brite
KEGG Orthology (KO) [BR:clt00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CM240_2447
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:clt03011]
    CM240_2447
Ribosome [BR:clt03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CM240_2447
  Bacteria
    CM240_2447
  Archaea
    CM240_2447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PH_TFIIH
Motif
Other DBs
NCBI-ProteinID: CDM69584
UniProt: W6S137
Position
rep1:complement(2658971..2659306)
Genome map
AA seq 111 aa AA seqDB search
MEAKAIARYVRMSPMKVNIVLDLIRGKSVNEAIVILQYTPKDAAQVVLKVLKSAVANAEH
NLNLNADNLYVSDAHTGQGPTLKRFRPHAQGRAFRILKKTSHITISVKERA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagctaaagctatagctagatatgtaagaatgtcacctatgaaggtgaacatagtt
cttgatcttataagaggtaagagcgttaacgaagcaattgtaatattacaatacactcca
aaggatgctgcacaagtagtacttaaggtgcttaagtcagcagtagcaaatgcggaacac
aatttaaatttaaatgctgacaacttatatgtttcagatgcacacacaggtcaaggtcca
acattaaagagatttagaccacatgcacaaggaagagcgtttagaatattaaagaaaact
agtcatattacaataagtgtaaaagaaagagcatag

DBGET integrated database retrieval system