KEGG   Clavispora lusitaniae ATCC 42720: CLUG_00329Help
Entry
CLUG_00329        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00790  Folate biosynthesis
clu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CLUG_00329
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:clu04147]
    CLUG_00329
Enzymes [BR:clu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     CLUG_00329
Exosome [BR:clu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLUG_00329
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 8500059
NCBI-ProteinID: XP_002619170
UniProt: C4XWK6
AA seq 150 aa AA seqDB search
MKQTLTRLAARASALTREEITRELEIINKQLPNEHWSAQFHDSSSEIRATYKLKTFAKTW
ELLNMIALQAQRLRHHPTITNTYNKIDLVITTHDAGNHVTDLDVKLAQAVHTAYAKNFVE
QTPIKNESKNHNDSRASKIIEELTRKYGKK
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagacattgacacgtttggcggctcgtgcctcggctcttacacgagaggaaatc
accagagagcttgaaatcatcaacaaacagctcccaaacgaacactggagtgcacagttc
catgattcaagttcggagatccgggcaacgtataaactcaaaacttttgccaaaacatgg
gagcttctaaatatgattgcattgcaagcgcaaaggctaagacaccacccaacaatcaca
aacacatataacaaaattgacttggtcatcacaacccatgatgcgggcaaccatgtaaca
gacttggatgtgaaacttgcacaggctgttcatacagcatacgctaaaaacttcgtggaa
cagacacctataaaaaacgagtcaaaaaatcataacgatagtcgtgcgtccaagataatc
gaagaattgactcggaaatacgggaagaaatga

DBGET integrated database retrieval system