KEGG   Clavispora lusitaniae ATCC 42720: CLUG_01659Help
Entry
CLUG_01659        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K01440  nicotinamidase [EC:3.5.1.19]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00760  Nicotinate and nicotinamide metabolism
clu01100  Metabolic pathways
clu04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CLUG_01659
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    CLUG_01659
Enzymes [BR:clu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CLUG_01659
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-GeneID: 8498505
NCBI-ProteinID: XP_002618200
UniProt: C4Y0C7
AA seq 242 aa AA seqDB search
MIKVAVIVIDVQEDFLPPNGTLAVPDGRDVISPICNILNAGRYPWSAVAITQDWHPETHC
SFASNHNVEPYSELEFKHPLGEKNGTTCEVKTQTQTVWPIHCVQGSPGAQVEKQVWEHFE
RIRKHLPSAVVKKGYLEDREYYSCFCDCWKLHRTEMTEFLQENQITDVVFVGLAYDYCVL
HSATDCSESGFNTYVIKDCCRSVFPDRIAQTEKQYSDAGVRLFDDADSLLKHFEECSRRH
AG
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggtggcggttatcgttattgatgtccaggaagattttctccctccaaacgga
acgttagcagttcccgatggtcgcgatgtgatctctcccatctgcaacatccttaatgct
ggaagatacccgtggctggctgtggcgataacccaggattggcatcccgaaacccattgc
ctgtttgcatcaaatcataatgtcgaaccgtattcagaacttgagttcaaacatcctctc
ggagagaaaaacggcacaacatgtgaagtgaagacacaaacgcagacagtttggccaatc
cactgcgtacaaggtctgccgggggcacaagtggagaaacaagtatgggaacattttgag
cgcatccgcaaacatcttccctctgcagttgtgaagaaaggctacttggaggacagagag
tactatctgtgtttctgtgactgctggaaattgcatagaacagagatgacagaattcctt
caagaaaatcaaatcaccgatgttgtgttcgtgggtcttgcttacgactactgtgtactc
cactcggccacagactgtctggaatctggcttcaacacatatgtgatcaaagactgctgc
cgcagcgttttcccagaccgcattgcccaaacagaaaagcaatatagcgatgcgggtgtt
cggctttttgatgacgctgatagtcttcttaaacatttcgaggagtgtagtagaagacat
gcgggttag

DBGET integrated database retrieval system