KEGG   Clavispora lusitaniae ATCC 42720: CLUG_01799Help
Entry
CLUG_01799        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00450  Selenocompound metabolism
clu00970  Aminoacyl-tRNA biosynthesis
clu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CLUG_01799
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CLUG_01799
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:clu01007]
    CLUG_01799
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:clu03016]
    CLUG_01799
Enzymes [BR:clu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CLUG_01799
Amino acid related enzymes [BR:clu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CLUG_01799
Transfer RNA biogenesis [BR:clu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CLUG_01799
 Prokaryotic type
   Other AARSs
    CLUG_01799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 MetRS-N tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 8498419
NCBI-ProteinID: XP_002618340
UniProt: C4Y0R7
AA seq 746 aa AA seqDB search
MNIATDRGSTLLALVNNLKVSIAAAAFAPEAQVEPADSGLLFRDSKSGFELAEANAIVKY
LAKDFAPSPVFAVEENEIYSALKSQSREKAVDALSKLSVPESTELSAANIVLYAAAYPFL
SEVSNLAQWAERFSSADAVTSGVARAKSVTVLVREMPKHTGAVHVHAGYLVKPQGDSILP
KDGERNILITSALPYVNNVPHLGNIVGSVLSADIYARYAKNRNYNALFVCGTDEYGTATE
TKALEEHVTPQELCDKYHKVHKDVYDWFDINFDYFGRTTTPLQTEIAQDIFMKLYHNNYL
EEQTTEQLYCEVHHSFLADRFVEGTCPKCAYEDARGDQCDKCGNLLNPFELIEPRCKLDN
SKPVPRNSTHVYLKLNELEPELKEWVEEAAEKGAWSKNSKTITNSWLKQGLDPRCITRDL
VWGTPVPLEKFKDKVLYVWFDATIGYVSITANYFKDKEIKDGWQQWWRNPENVNLYQFMG
KDNVPFHTVVFPATQIGTRDKWTKLHHLNTTEYLQYEDGKFSKSRGVGVFGNNARETGIS
PSVWRYYLASVRPETSDSHFSWKEFVTRNNSELLANLGNFVNRLVKFAIAKYNGVVPSYD
ANKIANYASFEKDVNDLLTSYIENMEAVNLRRGLEIAMAISSRGNQFLQDNKLDNSLFNN
TPDVSDAVVGVGLNLIYLVSAVISPFMPATRDQICEMLNAPALSITDKFEFVLEPGHNLG
KAQYLFKRIDEKMIDEWKAAYGGKQK
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgccacagatagaggtagcaccttacttgcgttggttaacaaccttaaagtc
agcattgcagctgctgcatttgctcctgaagctcaggtagagcctgctgactcgggtctt
cttttccgtgattctaagtctggcttcgaactcgcagaggccaatgccattgtcaaatac
ttggctaaagactttgctccaagccctgtctttgctgtcgaagaaaacgaaatctactct
gcactcaaatctcagtcccgcgaaaaggctgttgacgctttgagtaaactttctgttcct
gaatcaacagaattgtctgccgccaacattgttctttatgctgccgcgtatccttttttg
tctgaagtcagcaacttggcgcaatgggctgaacgtttttcttctgctgatgctgttact
tctggtgttgctcgtgcaaagtccgtgacagtcttggtcagagaaatgcccaaacacaca
ggcgctgtacatgttcacgccggctatttagttaagccacaaggcgacagtatccttcca
aaggatggcgaacgcaatattttgatcacttctgcgttgccatatgtgaataacgttcct
cacttaggaaacattgttggatctgtcttgtcggcagatatttacgcccgttacgccaag
aatagaaactacaacgctttgtttgtttgtggtacagatgagtacgggactgctactgaa
acaaaggcattagaggaacatgtcaccccacaagaattgtgtgacaagtatcataaagtg
cacaaggatgtttacgattggtttgacatcaactttgactacttcgggcgcaccacaaca
ccattgcaaacagagattgcgcaagacatctttatgaagttgtaccacaataactacttg
gaagaacaaaccacagaacaattgtattgtgaagttcatcactcctttttggccgaccgt
tttgttgagggaacatgtccaaaatgtgcctacgaagatgctcgtggtgaccaatgtgac
aaatgtggaaacttgttgaacccatttgaattaatcgaaccccgttgtaagcttgacaac
tcgaagcctgttccacgtaactctacccacgtttacctcaaattgaacgaattggaacct
gaattgaaagaatgggtagaagaagcagccgaaaagggcgcatggtcgaagaactctaag
accatcacaaattcctggttaaagcaaggcttggacccacgttgcatcacccgagactta
gtttggggtacacctgttcctttggaaaagtttaaggacaaggtgttgtacgtttggttc
gatgctacgatcgggtacgtttccattactgctaattacttcaaggacaaggaaatcaag
gacggttggcaacagtggtggagaaacccagaaaatgtgaacttgtatcaattcatgggt
aaggacaatgttccgttccatactgtggtgttcccagcaactcaaattggtacacgtgac
aaatggaccaagttgcaccacttgaacactacggagtacttgcaatatgaagacggcaag
ttttccaagtccagaggcgtgggtgttttcggaaacaatgcacgtgaaaccggcatctct
ccttctgtgtggagatattatttggcgtctgtgcgtccagaaacatctgactcgcacttt
tcgtggaaggagtttgtcaccagaaataactcggagcttttggccaacttgggcaacttt
gtcaatagattggttaaatttgccattgctaagtataatggcgttgtaccgagctacgat
gcaaacaagattgctaactacgcaagctttgagaaagacgttaatgacttgttgacttct
tacatagagaacatggaggctgtcaacttaagacgtggtttggagattgccatggctata
tcctctcgcggaaaccagttcttgcaggacaacaagttggacaactcgcttttcaacaac
actccagatgtttctgatgctgttgtaggtgtgggattgaacttgatctacttggtttct
gctgtcatttccccattcatgccagcgacccgtgaccaaatttgtgagatgttgaacgct
ccagccttgtcgatcacagacaagtttgagtttgttttggaaccaggtcacaacttgggc
aaggcgcagtacttgttcaagagaatagatgagaagatgattgacgagtggaaggcggcc
tacggaggtaagcagaagtag

DBGET integrated database retrieval system