KEGG   Clavispora lusitaniae ATCC 42720: CLUG_02094Help
Entry
CLUG_02094        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00010  Glycolysis / Gluconeogenesis
clu00053  Ascorbate and aldarate metabolism
clu00071  Fatty acid degradation
clu00280  Valine, leucine and isoleucine degradation
clu00310  Lysine degradation
clu00330  Arginine and proline metabolism
clu00340  Histidine metabolism
clu00380  Tryptophan metabolism
clu00410  beta-Alanine metabolism
clu00561  Glycerolipid metabolism
clu00620  Pyruvate metabolism
clu01100  Metabolic pathways
clu01110  Biosynthesis of secondary metabolites
clu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:clu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLUG_02094
   00053 Ascorbate and aldarate metabolism
    CLUG_02094
   00620 Pyruvate metabolism
    CLUG_02094
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CLUG_02094
   00561 Glycerolipid metabolism
    CLUG_02094
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLUG_02094
   00310 Lysine degradation
    CLUG_02094
   00330 Arginine and proline metabolism
    CLUG_02094
   00340 Histidine metabolism
    CLUG_02094
   00380 Tryptophan metabolism
    CLUG_02094
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CLUG_02094
Enzymes [BR:clu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CLUG_02094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 8498480
NCBI-ProteinID: XP_002618635
UniProt: C4Y1L2
AA seq 556 aa AA seqDB search
MAPSKKSVKKSPVPTETTKPTKVAPQTASAPQSVLKYTSKEDIPAIVQNLTKQHNQEHQT
HSLQFRLNQLRNIYFAVKDNIDAFSEALYKDFGRSPEETLTLEYVTFMNELVHTMAHLHK
WMKPTPVDGLTLAVKTNSVYVEHVPLGVVLIIAPFNYPLLLSLSSLIGAISAGNSVVLKV
SELTPHFAQKLTEVLTSVLDPSVFAMVNGGVEETTLLLDQKFDKIMYTGSTTVGKIIAKK
AAETLTPVLLELGGKSPAFVLEDVKESEIDAVARRIVWGRFTNAGQTCVAIDYVLVHETL
KEKLVSAIVKVVEEQFYKTLDAKDPSYTHIIHQRAFDTLKKMIESSSGKICTGGTTDAET
RFIAPTVIDNVDWSDSTMQQEIFGPVLPILTYTDLKAAVKQVVTRHDTPLASYIFTSGSH
SRAKNIDLDYIQTNIRSGGTVINDSVLHVSLANAPFGGIGNSGQGAYHGIYSFRAFSHER
TTMETKLSMDFAVSSRYPPCEPKKINVMQSSMTSYNGAVWFGRTGDVKPNGPSSLWSAWK
GTLGVSALLYYLFQAM
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggccccttccaagaaaagtgtcaagaaaagtcctgttccaacagagacaaccaagccg
accaaagtagcgccacaaactgcgtcggcaccgcaatccgtcttgaaatacacctccaag
gaagacatccccgcaattgtccagaacctcaccaaacagcacaatcaagagcaccaaaca
cactcgttgcagttccgtttgaaccaattgagaaacatctactttgctgtgaaggacaat
atcgatgctttcagcgaagctttgtacaaggactttggccggtcccccgaggaaacactc
actttggagtatgtgacgtttatgaacgaattggttcacaccatggcacacttacacaag
tggatgaagccaactccagtggatggattgactcttgcagtgaagacaaactcggtttat
gtggaacacgttcctctcggagtggtgcttatcattgctcctttcaactacccattgctt
ttgtcgctttcttctctcattggcgccatttccgcaggcaactctgtcgtattgaaagtg
tcggagctcactccacatttcgcccagaaactcactgaagtgctcacatcagtacttgat
ccgtctgttttcgccatggtcaatggtggtgtagaagagactacactcctcttggatcag
aagtttgacaaaattatgtatacgggctccactactgtgggcaagatcattgcgaagaaa
gctgcagaaacactcacgcctgtgcttttggaacttggaggcaagtcgccagcattcgtt
ttggaggacgtcaaggagctggaaattgacgctgtggccagaaggatagtatggggccgt
ttcaccaatgctggacaaacgtgtgttgccatagattacgtgttggtgcacgaaacactc
aaggaaaagttggttagtgccattgttaaggtggtggaggagcagttctacaagactttg
gatgcgaaagacccatcgtatacacacattatccaccaaagagcctttgacactttgaag
aagatgatcgagctgtcttccggaaagatttgcacgggcggaactactgacgccgaaaca
agatttattgctcctactgtcattgacaatgtcgactggtcggactctacgatgcaacag
gagatttttgggcccgtcttgcccattttgacatacacggacttgaaggctgcagtcaag
caagttgtcacccgccatgatactccgttggccctgtatattttcacgtcgggctcccat
tctcgggccaagaatatcgacttggactacatccaaacaaacatcagatcgggtggcact
gttatcaatgacagcgtgttgcacgtttctttagcgaatgcgccgtttggaggtattggt
aactcgggccaaggcgcataccatgggatctattcgttcagagcattttcgcatgagcgt
acgacgatggaaacaaagctctccatggactttgctgtcagctcaagatacccaccttgc
gagccaaagaaaatcaatgtgatgcagctgtctatgacttcttacaatggcgcagtatgg
tttggccgcactggagacgtgaagcccaatggaccaagtctgttatggtctgcgtggaag
gggactttaggtgtaagcgctttgctctactatttgttccaggccatgtaa

DBGET integrated database retrieval system