KEGG   Clavispora lusitaniae ATCC 42720: CLUG_02864Help
Entry
CLUG_02864        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00010  Glycolysis / Gluconeogenesis
clu00020  Citrate cycle (TCA cycle)
clu00620  Pyruvate metabolism
clu01100  Metabolic pathways
clu01110  Biosynthesis of secondary metabolites
clu01130  Biosynthesis of antibiotics
clu01200  Carbon metabolism
Module
clu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLUG_02864
   00020 Citrate cycle (TCA cycle)
    CLUG_02864
   00620 Pyruvate metabolism
    CLUG_02864
Enzymes [BR:clu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CLUG_02864
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 8498354
NCBI-ProteinID: XP_002617420
UniProt: C4Y2V1
AA seq 467 aa AA seqDB search
MSALFVHRAAFTLRAVAGNTSRSYLASSFSLQMARLYSSGKFPPHTVINMPALSPTMTQG
GIAAWSKSVGDELTPGEAIAEIETDKASMDFEFQEEGYLAKILVEAGTSDIPVGKPIAVY
VEDSSDVPAFESFTAEDAAGAEAPAPAPKEEKTEEPKAEEKPASSAPSKPSTPSKAPTGR
IFASPLAKTIALDRGISLKNIKGSGPKGRIIAKDVENIKPAEAAPAASAAPAAATYEDIP
LTAMRKTIASRLLQSTQQSPSYIVQSQLNVSKLLKLRQSLNATAEDRYRLSVNDLLVKAI
ALASLRVPEVNSAWMGEENVIRQYNVVDVSVAVATPTGLITPIIKNAHTKGLATISAEVK
DLGKRAKAGKLAPEEYQGGTICISNLGMNNAVNAFTSIINPPQSAIVAIGTVDKKAIPSS
VNEQGFVFADVITVTGTFDHRTVDGAKGGEWIRELKKIVENPLEFLI
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctttgttcgttcacagagccgccttcaccttgcgtgctgtggccggcaacacc
tccagatcctaccttgcctcttccttttctttgcaaatggcaagattgtactcatccgga
aagttcccccctcacactgtcatcaacatgccggctttgtcgccaaccatgacccaaggt
ggtatcgctgcttggtctaagagcgttggtgatgagttgactcctggtgaagccattgcc
gagatcgaaaccgacaaggcctcgatggactttgaattccaagaagaaggttacttggct
aagatcttggttgaggctggcaccagcgacatccctgttggtaagccaattgctgtttat
gttgaagacagcagcgatgtgcctgcttttgaaagcttcactgctgaagatgcagccggt
gccgaggctcctgccccagcaccaaaggaggagaagaccgaagagccaaaggccgaggaa
aagcctgcctcatctgctccatctaagccatctaccccatctaaggctccaactggcaga
atcttcgcctctccattggccaagaccattgctcttgacagaggtatctctttgaagaac
attaagggttccggtccaaagggcagaatcatcgccaaggatgtggagaacatcaagcct
gccgaagctgctccagctgcttctgccgctccagctgctgccacctacgaagatattcct
cttacggctatgagaaagaccattgcctccagattgttgcaatccacccaacagtcacca
tcttacattgtccaatcccaactcaatgtctccaagttgttgaagttgcgtcaatccctc
aacgctactgctgaagacagatacagattgtctgtgaacgacttgttggtcaaggctatt
gctttggcttccttgagagttcctgaagtcaactctgcttggatgggcgaagaaaatgtc
attagacagtacaacgttgttgatgtttctgtcgctgtcgctacccctactggtttgatc
accccaatcattaagaacgctcacaccaagggcttggctaccatttctgcagaagtcaag
gacttgggtaagagagctaaggctggtaagttggctccagaagaataccaaggcggtacc
atctgtatctctaacttgggtatgaacaacgccgttaacgcattcacttctatcatcaac
ccaccacaatctgctattgtcgctattggtactgttgacaagaaggctattccatcttcc
gtgaacgagcaaggtttcgttttcgctgatgtcatcactgttaccggtacttttgaccac
agaactgtggatggagccaagggcggtgaatggatccgtgaattgaagaagattgtcgaa
aacccattggaattcttgatctaa

DBGET integrated database retrieval system