KEGG   Clavispora lusitaniae ATCC 42720: CLUG_03122
Entry
CLUG_03122        CDS       T01149                                 

Definition
(RefSeq) similar to ERG24
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00100  Steroid biosynthesis
clu01100  Metabolic pathways
clu01110  Biosynthesis of secondary metabolites
Module
clu_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:clu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    CLUG_03122
Enzymes [BR:clu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     CLUG_03122
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 8497601
NCBI-ProteinID: XP_002617678
UniProt: C4Y3K9
AA seq 441 aa
MASLNPKTTEKEFFGMFGALGIPIFLPLLIIFFQLITNSHYAIKGISLDLSKVIEQIPQS
WSELADICFDKKCWVAYLVWFFVLAVFDVYSPGRDVEGVELRDGTKLMYRINGRFMSSLL
VVIIVARAFASENFYLPELQFLYDNQLQLTMVTIIFSFLLSFFVYFCSFIPLRRPNGAKT
KERILSINGNSGNAIYDWFIGRELNPRIGSWDIKLFCELRPGMLLLFLINLSCLHQQYHI
QGKVADSMWLVNAMQAFYIFEGVLNEEGCLTMMDIATDGFGFMLAFGDLAWLPWSYSLQA
RYLALPGNAYHLGWLKCSLILLVNVLGYYIFHSANQQKSDFKQGKLKHLKSITTPTGSKL
LADGWWSTSQHINYFGDWLIGWSWCLPTGTMTLLTYFYVIYFGVLLVHRQTRDEAKCRNK
YGKAWEEYEKQVPYKIVPYVY
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggcactgttgaatcctaaaacgacggagaaagagtttttcggcatgtttggtgcccta
ggcatcccaatattcttgcccttgctcattattttcttccaattgatcacgaactctcat
tacgccatcaaaggtatcagtctcgacttgtctaaagttatcgagcaaatcccccaatcg
tggagtgaactagcagatatttgcttcgacaagaaatgttgggttgcctatcttgtgtgg
ttcttcgttcttgcagtatttgatgtctactctccaggcagagatgttgaaggtgttgaa
ttgagagacggaacgaagttgatgtaccgtattaatggtcgtttcatgtcctctttgttg
gtagtaatcattgttgcaagggcatttgcgtcagaaaacttttacttgccggaattacag
ttcctctatgacaatcagttacagttgacaatggttacaattattttctcattcttgcta
tccttcttcgtttacttttgctccttcatcccattacgccgccctaatggtgccaagaca
aaggaaagaatcttatccatcaacggaaactctggtaacgcaatctacgactggttcatc
ggaagggagttgaacccaagaattggttcttgggacatcaaattgttctgcgaactcaga
ccaggcatgcttttgctattcttaattaacttgtcatgtcttcatcaacaataccacatc
cagggaaaagtggctgattcaatgtggttggttaacgccatgcaagcattttacatcttt
gaaggtgtccttaatgaagaaggttgtttgaccatgatggatattgctaccgatggattc
ggctttatgcttgcctttggtgacttggcttggcttccgtggtcgtactcattacaggct
cgctacttggcattaccaggaaatgcataccacttgggctggctcaaatgctctctcatt
ttgttggtgaacgttttgggttactatattttccactctgccaatcagcagaaatcggac
tttaagcagggcaaattaaagcacttgaaaagcatcacgacacccacaggctcgaaatta
cttgctgacggttggtggagcacgagtcagcatatcaattacttcggagactggcttatt
ggctggtcttggtgcttacccacgggcactatgactttactcacatacttttacgtcatt
tactttggcgttttgttggttcacagacagactcgtgatgaagccaagtgtagaaacaaa
tatggcaaggcgtgggaggagtacgagaaacaagttccatacaagatcgtgccatacgtt
tattaa

DBGET integrated database retrieval system