KEGG   Clavispora lusitaniae ATCC 42720: CLUG_03370Help
Entry
CLUG_03370        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K01405  saccharolysin [EC:3.4.24.37]
Organism
clu  Clavispora lusitaniae ATCC 42720
Brite
KEGG Orthology (KO) [BR:clu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:clu01002]
    CLUG_03370
Enzymes [BR:clu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.37  saccharolysin
     CLUG_03370
Peptidases and inhibitors [BR:clu01002]
 Metallo peptidases
  Family M3
   CLUG_03370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M3 Peptidase_M50B
Motif
Other DBs
NCBI-GeneID: 8496734
NCBI-ProteinID: XP_002616129
UniProt: C4Y5D6
AA seq 706 aa AA seqDB search
MLNYQRVFLFLAIAVLSFFLTPMSQPDLQALAAAQPSPKWTATPQEILDAAEKLKAEEIA
FNDHIASIEDPTVENVLIPTTRHENERYFDENSITFYQYVSPDKDVRDASTKAEQILDEC
SIEQSSRVDVFRVYKKLWEKVKDSADLDAETRKFLEKTVNYYKRNGLDLPDDKREQVKKL
KIELSNLSTTFSKNTNEENGFLKFTAEQLEGVPESVMEQFEKVTEDGTDFFKVTFKYPDI
LPVLKYAKNQETRKTAYVENQNKVPENAEILDKIIRLRYQIAKLMGYETYSEFVLEDRMA
KNQKNVLQFLGDLKDKLQPLGKKELAKMLEFKNADLKERGLPEQDTFYAWDNSYYNNLLL
EKEYQVDHQKISEYFPLDQTIERMFAFYEKLFDVKFVKIEKPDSDSVWHEDVRKFAVYQN
IKYGEPKPQFMGWIMFDLHPREGKYTHAAHFGLQSGFVKSDGTRQGTYSALVCNFTKPTK
TKPSLLKHDEVTTFFHELGHGVHCLLSQTKYARFHGTSVPRDFVECPSQMLEFWTWSANE
LKALTSHFETSEPIPDQLIDQLVKSKHVNTGLFNLRQLHFALFDMSLHTIDTQEKIDALD
LTKSWNELREEIALISNGGIDNTGYSTFGHIAGGYESGYYGYLYSQVFATDIYYTHFKSD
PMNVERGIRYRDTILKNGGSKEILDILEELLGRAPNSDAFLQEILG
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgctaaattaccagcgggtgttcctttttctagcaatcgctgtgcttctgttttttctc
acgcccatgtcccaaccagatcttcaagcattggctgcggcccaaccttctcccaaatgg
accgctacacctcaagaaattttggatgcggctgaaaagttgaaggctgaagaaatcgcc
ttcaacgaccacattgcgtcgatcgaagatcctaccgtggaaaacgttttgatcccaacc
acgcgccacgaaaacgaaagatactttgacgaaaacctgatcactttctaccagtatgtg
tctccagacaaagacgtcagagacgcctcgaccaaagcggagcagattttggacgagtgt
ctgattgagcagagctctagagtcgacgttttccgcgtctacaagaaattgtgggaaaag
gtcaaggactcggccgatttggacgccgaaacccgcaagtttttggagaaaaccgtcaac
tactacaaaagaaacgggttggatttgcctgacgacaagagagaacaggtcaagaagctc
aagattgaattgagcaacttgtccacaacgttttccaaaaacaccaacgaagaaaatggg
ttcctcaagtttactgctgaacagttggaaggtgttccagaactggtgatggagcagttc
gaaaaggttaccgaggacggcactgatttcttcaaggtcactttcaagtacccggacatt
ctccctgtgttaaagtatgccaagaaccaggagacaagaaagaccgcttatgttgagaac
caaaacaaggtccccgagaacgcagagatcttggacaagatcatccgtctccgctaccag
attgcaaagttgatgggctacgaaacatactcggagtttgtgttggaggacaggatggcc
aaaaaccaaaagaatgtcttgcagtttttgggtgacttgaaagacaagttgcaacctttg
ggcaagaaagagcttgccaagatgttggagttcaagaatgcagatctcaaggaaagaggc
cttccggaacaggacactttctacgcctgggacaacagctactacaacaacttgttgttg
gagaaagagtaccaggttgaccaccaaaagatttctgaatacttccctcttgaccagacc
atcgagagaatgttcgccttctacgaaaaactcttcgacgtcaagtttgtcaagatcgaa
aagcctgactcggattctgtttggcacgaggatgttcgcaagtttgctgtttaccaaaac
atcaagtatggcgagcccaagccccagttcatgggctggataatgtttgatctccatcca
cgtgaaggtaaatacacccacgctgcccactttggcttgcaatcgggatttgtcaagtca
gatggcacaagacaaggaacttactcggctttggtttgtaacttcaccaaaccaacaaag
acaaagccatctttgttgaaacacgacgaagtgacaactttcttccatgagttgggccac
ggcgtccactgtttgttgtcccaaaccaaatacgcccgtttccatggaactagtgttcca
agagactttgtcgaatgtccatcgcagatgttggagttctggacgtggtctgccaacgaa
ctcaaggcattgacgtctcactttgaaacttccgagcctattcctgaccagttgatcgac
cagttggtcaagtccaagcatgtgaacacaggtttgttcaacttgagacagttgcacttt
gctcttttcgacatgagtctccacaccatcgacacgcaagagaaaatcgatgcgcttgac
ttgaccaaactgtggaacgagttgagagaagagattgccttgatctccaatggaggtatc
gacaacactggatactctacttttggccacatcgcgggaggatatgagtcgggttactat
ggctacttgtactctcaggttttcgccacggacatttactatactcatttcaagtctgac
cctatgaatgtggaaagaggtatccggtacagagacaccattttgaagaatggtggatcg
aaggagatccttgatattttggaggagttgttgggcagagcacctaactctgatgcgttt
ttgcaagagattttgggttag

DBGET integrated database retrieval system