KEGG   Clavispora lusitaniae ATCC 42720: CLUG_03683Help
Entry
CLUG_03683        CDS       T01149                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00010  Glycolysis / Gluconeogenesis
clu00051  Fructose and mannose metabolism
clu00562  Inositol phosphate metabolism
clu01100  Metabolic pathways
clu01110  Biosynthesis of secondary metabolites
clu01130  Biosynthesis of antibiotics
clu01200  Carbon metabolism
clu01230  Biosynthesis of amino acids
Module
clu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
clu_M00002  Glycolysis, core module involving three-carbon compounds
clu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLUG_03683
   00051 Fructose and mannose metabolism
    CLUG_03683
   00562 Inositol phosphate metabolism
    CLUG_03683
Enzymes [BR:clu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CLUG_03683
Exosome [BR:clu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CLUG_03683
  Exosomal proteins of bladder cancer cells
   CLUG_03683
  Exosomal proteins of melanoma cells
   CLUG_03683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 8496564
NCBI-ProteinID: XP_002616442
UniProt: C4Y699
AA seq 248 aa AA seqDB search
MARQFFVGGNFKMNGTKESITKIIDNLNKADLPKDVQVVIAPPAPYLSLAVAENKQSTVA
VAAQNVFNKASGAYTGEISPEQLKDLGATWTLTGHSERRTIIKESDEFIAEKTKFALDSG
VSVILCIGETLEERKAGITIDVCARQLDAVSKIVSDWTNIVVAYEPVWAIGTGLAATPQD
AQDTHKEIRAHLAKTIGAEQAEKVRILYGGSVNGKNAPEFKDKVDVDGFLVGGASLKPEF
VDIIKSRL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcaatttttcgtcggtggtaacttcaagatgaacggtaccaaggagtcgatc
actaagatcattgacaacttgaacaaggctgacttgccaaaggatgttcaagtcgttatt
gctcctccagctccatacctctctttagctgttgctgagaacaagcaatccactgttgct
gttgctgctcaaaacgttttcaacaaggcctctggtgcttacactggtgaaatctcgcca
gaacaattgaaggacttgggtgccacctggactttgactggtcactctgagagaagaacc
atcatcaaggaatccgatgaattcattgccgaaaaaaccaagtttgctttggactctggt
gtcagcgtgattttgtgtattggtgagaccttggaagaaagaaaggccggcatcaccatt
gatgtttgcgctagacaattggacgccgtttccaagattgtttccgactggactaacatt
gttgttgcctacgaaccagtctgggctattggtactggtttggccgctaccccacaagat
gctcaagacacccacaaggaaattagagctcacttggccaagaccattggtgctgagcag
gctgaaaaggtcagaattttgtacggtggttctgtcaacggcaagaacgctccagagttc
aaggacaaggttgatgttgacggtttcttggttggtggtgcttcgttgaagccagagttc
gtggacatcatcaagtccagattgtaa

DBGET integrated database retrieval system