KEGG   Clavispora lusitaniae ATCC 42720: CLUG_04020Help
Entry
CLUG_04020        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00350  Tyrosine metabolism
clu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    CLUG_04020
Enzymes [BR:clu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     CLUG_04020
Exosome [BR:clu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CLUG_04020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 CmcI
Motif
Other DBs
NCBI-GeneID: 8496585
NCBI-ProteinID: XP_002616779
UniProt: C4Y786
AA seq 254 aa AA seqDB search
MSLEEELLNYIFSLPNLEEIKGSPKKVIEAIDEFVKKNPMMIIGKHKGQLILDHIKESEP
DCMIELGCYVGYSAILFAGALSELERDDCFSKYYSFEVNSAFAKIASKLIDLAGLSHMVE
IIVGPAGSTLPDFAERIASEYKRYKAIDAIFIDHWKDMYVPDLRVLESLSLIGPGTYIFA
DNILNPGVPDYVDYVQGDPEFRKEYNAAHENISSSILQGRWNILYESQTYPVTDPDTGRK
DAVEITKCVEYLSG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttggaagaagagcttttgaattatatttttagtttgcctaaccttgaggaaatc
aaaggttcgcctaaaaaggtcattgaagccattgatgaatttgtcaagaaaaatccaatg
atgatcataggtaaacacaaaggtcaattaattttggatcacatcaaagagtcggaacca
gattgtatgattgaattgggctgctatgttggatatctggcaattttgttcgcgggcgca
ttatctgagttagagagggatgattgcttctcaaagtattacagttttgaagtcaattct
gcttttgccaaaatcgcttctaagttgattgatcttgctggtctttctcatatggttgag
atcattgtgggcccagccggatctactctccctgattttgccgagcgtattgcctctgaa
tacaagagatataaggcaattgatgctatcttcattgaccattggaaagacatgtacgtt
cctgacctccgtgttcttgagtcgctttccctcattgggcccggtacgtacatttttgct
gacaatattttgaatcctggtgtacctgattatgtggactacgtgcaaggcgacccggaa
ttcagaaaagagtacaatgcggcccatgagaacatcagcagctccattcttcagggtaga
tggaatattttgtatgagtcacagacatatccagtcacagatcctgatactggtcgcaag
gatgcagttgaaattacgaagtgcgttgagtatctttctggataa

DBGET integrated database retrieval system