KEGG   Clavispora lusitaniae ATCC 42720: CLUG_04350Help
Entry
CLUG_04350        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K05355  hexaprenyl-diphosphate synthase [EC:2.5.1.82 2.5.1.83]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00900  Terpenoid backbone biosynthesis
clu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLUG_04350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:clu01006]
    CLUG_04350
Enzymes [BR:clu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.82  hexaprenyl diphosphate synthase [geranylgeranyl-diphosphate specific]
     CLUG_04350
    2.5.1.83  hexaprenyl diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     CLUG_04350
Prenyltransferases [BR:clu01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   CLUG_04350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 8496163
NCBI-ProteinID: XP_002615468
UniProt: C4Y822
AA seq 535 aa AA seqDB search
MATFYRPGISSGLFRPQNLVRVQKQQWAHACTRTSIIVTPTRQKAKNQSGPSTMSHFRPR
NFRLSPLLASAVRSVHTNTFPAAVEAAEKMVQPRKSAFSDPFSIVSHEMSNMAKSIAQLI
GSGHPTLNRVSSYYFEAEGKNVRPLIVLLLSKALSAIPIEERDRVPIDYLDVTDQPVYPG
TPQETVLAGQSPNESISPLAILHGINPRVILDPLSKPLDRLPELDAANGILPKQRRLAEI
VEMIHTASLLHDDVIDLSDARRGRPSGNIAFTNKMAVLAGDFLLGRASVAISRLRNPEVV
ELISTSIANLVEGEFMQLKNTVLTDDKTVNNDGDEKVVPTPTGKVPVEQHEYSVASPGQS
GENGQVSHDTNVDAAFEYYLHKTYLKTASLMSKSARSAAVLSGARDNVVDSCYDFGRNLG
LCFQIVDDMLDYTSSDAAFGKPSQADLKLGLATAPVLFAWRKEPKLGALIARKFSEPGDV
EIARRAVERYDGVAQTRKMAQDYCNRALTSLRVLPESDARSALELLTHSVLTRTN
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccttctatcgtccaggaatatcctccggccttttccgccctcaaaacctcgtc
cgagtgcaaaaacagcagtgggcacatgcctgcacccgtacctccatcatcgtcacacct
actcgccaaaaagccaaaaaccaatctggccccagcaccatgagccactttagaccgcgc
aatttccggctctcgccacttcttgcgagcgccgttcgctctgtgcacacaaacacattc
ccggccgccgtggaagcggcagagaaaatggtgcagccgcggaaactggccttctcagac
ccgttttccatcgtctcgcatgaaatgtccaacatggccaagctgattgcgcagttgatc
gggtcgggccacccgacgctcaatcgtgtgtcgagctactacttcgaggccgagggaaag
aatgtcaggccgttgattgtgttgcttctttccaaagcattgctggcaattcccatcgag
gagcgggaccgtgttcccatcgactacttggacgtcacggaccagcccgtgtacccggga
acgccccaggaaacggtgttggccgggcagctgccaaacgagtccatttcgcccttggca
attttgcacggcatcaatccgcgggtcattttggaccccttgtccaagcccttggacagg
ttgcccgagcttgatgcggccaacggaattttgcccaagcagcggcgcttggcggagatt
gtggagatgatccacacggcgtcgcttctccacgacgatgtgattgacttgtctgacgct
agaagaggcaggccaagcggcaacattgccttcaccaacaaaatggcggttttggccggc
gactttttgttgggccgtgcgtctgtggccatttcccgcttgcgcaatcccgaggtggtg
gagttgatttcaacctccattgccaacttggtggaaggtgagttcatgcagttgaaaaac
accgtcctcaccgacgacaagaccgtcaacaacgacggcgacgagaaagttgtccccacg
ccaacggggaaagtcccagtggagcagcacgaatactctgtcgccagtccgggccagctg
ggcgaaaacggccaggtttcccacgacaccaacgtcgacgcggccttcgagtactacttg
cacaaaacatacctcaagactgcgtcgttgatgtcaaagctggcgcggtctgctgctgtt
ttaagcggcgccagagataacgttgtggatctgtgctacgactttggccgcaacttgggc
ttgtgtttccagattgtcgacgacatgttggactacacctcatccgacgcggcgttcggg
aaacccagccaggccgacttgaagttggggcttgccacggctccggttttgtttgcatgg
cgcaaagaaccaaagttgggtgcgctcattgcgagaaagttttccgagccgggcgacgtg
gagattgctcggcgggctgtagaacgctacgacggcgtggcccagacacgcaaaatggca
caggactattgcaaccgggcattgaccagcttgcgtgttttgcccgagctggacgctcgt
ctggccttggagctcttgacccacctggttttgactagaacaaactga

DBGET integrated database retrieval system