KEGG   Clavispora lusitaniae ATCC 42720: CLUG_04701Help
Entry
CLUG_04701        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K03254  translation initiation factor 3 subunit A
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:clu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    CLUG_04701
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:clu03012]
    CLUG_04701
Translation factors [BR:clu03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    CLUG_04701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI DUF3499
Motif
Other DBs
NCBI-GeneID: 8495837
NCBI-ProteinID: XP_002615819
UniProt: C4Y924
AA seq 649 aa AA seqDB search
MPPAHKNQALRPENILKRAEDLIGVGEREASLETLYEFITSKRIRYLQVEDLEPIASLLI
ELAVDLRKGKLAKDALHQYKKNVQMSEHGLESVEVIVRQFISLAEKKLDEAQAKADIKID
QDEEEDLEDSQTPESILLSAVSNTDSADRTERELVTPWLRFLWEALRAVLDILRNNSKLE
VTYSAIVNQAFQFCLKFNRKAEFRRLCELLRAHMQSVTTQVPAKGTGTNINAVDLSDPET
VQRYLEQRFAQLNISVKLELWQESFRSVDDVHTLITASKKAPKPVMMANYYENLARIFAV
SDNNLYHAAAWNKFFNLFSQSPNATDKELSHYASVLVLSTLAIPTKSLNVNETVVDEQKA
KNAKLTSLLNLNQVPTRDSLISSIVNRSILKFVDEPIKKLFEIMSDSEFHPLTVKERVAE
VFQILKDDKAYSKYIPTLTEVVLIRSFQQVSQIYEAVKLDFLVSLGIIEGTEYTLTPLEV
EDLIVNSVKKGHLSLTIDHESQVVTFKSNPFEDSFNDSLSSKLQASPAELVRNQLSKLAY
VLANSVKVIDPQAEARKKHRTDIALQNAIADFVREQREIAERVEILEERKKIADKIKREE
EEAAAKARQEKLLAEQKAEQERLAKEQERKNQERLERERTRSLRKIRER
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgcctccagcacacaagaaccaggcgttgcgtcctgaaaacattttaaagcgtgccgaa
gaccttattggcgtcggagaaagagaagcttccctcgaaactttgtatgagtttatcacc
tccaagagaattcgttacttgcaagttgaggatttggagcctatcgctctgttgcttatt
gagttggctgttgacttaagaaagggaaagttggccaaggatgctttgcaccaatataag
aaaaacgtgcagatgtctgaacacggtttggaatctgttgaagtaatcgttagacagttc
atttctttggctgagaaaaagttggacgaagcccaagcaaaggctgacattaagatcgat
caagacgaggaagaagatttggaagactcccaaacgcctgaaagcatcttgttgtctgct
gtctccaacacagactctgcggacagaaccgagagagaattggtcaccccttggttgaga
ttcttgtgggaggcacttagagctgttttggatattttgagaaacaactccaagttggaa
gtcacatactctgctattgtgaaccaggctttccaattctgtttgaagttcaacagaaag
gctgagtttagaaggttatgtgagctcttgagagcacacatgcaatctgtcactactcag
gtcccagccaagggtacaggcacaaacattaatgctgttgatttgtctgatcctgaaact
gtccaacgttatttggaacaacgttttgctcagttgaacatttctgtcaaattggaattg
tggcaagagtccttccgttccgttgacgatgtgcacactttaatcacagcttctaagaag
gcccctaagcccgttatgatggctaactactatgaaaacttggccagaatttttgctgtt
tcagacaacaatttgtaccacgcagccgcttggaacaaattcttcaatttgttctctcaa
tcccctaacgccaccgacaaggagttgagccactacgcctctgttcttgttttgtctacc
ttggcgatcccaacaaagtcattgaatgtcaatgaaactgttgttgacgaacaaaaggcc
aagaacgccaaattgacctctttgttaaacttgaaccaagtgccaacgagagacagcttg
atttcctctattgtcaacagatctattttgaagtttgtggatgagccaatcaagaaattg
ttcgagatcatgagcgattctgagttccacccattgactgtcaaagaaagagttgctgag
gtgtttcaaattctcaaagatgacaaagcttacagcaagtacattccaacattgaccgaa
gttgttttaattagatctttccaacaagtttctcagatttatgaggctgtgaaattggat
ttcttagtttctttgggtattattgaaggtactgagtataccttgacacctttggaagtt
gaagacttgattgtcaattctgttaagaaaggtcacttgtctttgactattgatcacgaa
tctcaagttgttaccttcaagtccaatccattcgaggattctttcaatgactctttgtca
tctaagttgcaagcttccccagctgaattggtcagaaaccaattgtccaaattggcttac
gttttagcaaattctgttaaggttattgacccacaagctgaggcccgcaagaagcacaga
actgacatcgcattgcaaaatgctatcgctgactttgttagagaacaacgggaaattgca
gaacgagttgaaattttggaagaacgcaaaaagattgcagacaaaatcaagcgtgaggag
gaagaggctgcagctaaggcgagacaagagaaattacttgctgagcaaaaggccgagcaa
gaaagattagccaaggaacaggagagaaagaaccaagagcgtttagaaagagaaagaaca
cgatcattgagaaagataagagaaagatag

DBGET integrated database retrieval system