KEGG   Clavispora lusitaniae ATCC 42720: CLUG_04890Help
Entry
CLUG_04890        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:clu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CLUG_04890
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:clu03041]
    CLUG_04890
Enzymes [BR:clu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     CLUG_04890
Spliceosome [BR:clu03041]
 Complex C
  Other components
   Step II factors
    CLUG_04890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 T2SSE AAA_19 Flavi_DEAD ATPase PhoH AAA_7 SRP54 AAA_11
Motif
Other DBs
NCBI-GeneID: 8495351
NCBI-ProteinID: XP_002614875
UniProt: C4Y9K0
AA seq 1131 aa AA seqDB search
MVGWLKYVDSISIACTWPYNHLMAMRLNFMSGPLLKKVAAAVEKHLGVADSDETLSRFLL
SLYEEPLEAFSRAVEANGGSDFPPAFVHEVFEAIREESKSKESKESKSKESKDGSKREEQ
VETEPENQVHEKPAETQRERLPSERSKDTGTEQRTQKDHNNQHQSHQNQNQNHQHQNHQN
HQDQQNQNQQNQQNLHAPEPNLVVGAVCRGTVSNITSYGAFVRLNRFESGLCHISKMSYD
GRRVGSPGDVVKQNQEVFVRITDVGSGRRRKIALSMVGVDQTNGEYVEGRESGRQSGRDT
EFGRRGREMGRDRAVSSGARRLTSPERWEIRQLIAAGAARASDYPELYEVEEDPAESEGF
EVEINPHEPKFLQGQVRARAEPAHILKNPEGSLSRAAMDGSRLAQEMREQKKEQRKKEKQ
QGTEEKNKDKEQNKDKEQSKGKEQAPYSKSRKNVSKSDLAQSRKRLPVYAMREQLLSAVR
DNQFVIVVGETGSGKTTQIVQYLYEENFHRGDKIIACTQPRRVAAESVAKRVAQEVGCPL
GQEVGYTIRFDDRTSPATRIKYMTDGMLQREALLDPQMSKYAVVMLDEAHERTVATDVLF
ALLKKAARANPDLRVLATSATLDADKFSRYFGGCPVLHVPGRTFPVEIMYSREPEPDYVA
AALDCVMQIHVAEDSGDILVFLTGQDEIDTCCEALEARIKTLGRAVPELLVLPAYSALPP
DQQARIFEPAPPGARKVVLATNIAETSITIDGIRYVVDPGFVKLNAYDPRLGMDSLVVSP
ISQAQANQRSGRAGRTAPGKCFRLYTEEAFRTEMRPNTVPEIQRQNLEHTILMLKAMGID
DVLRFEFMDPPPAPTTVQALKELYVLDALDENGHLTSMGRRMADFPMEPALAKTVLASVD
LSCASDVLSVVAMLSVQNVFYRPKDKQAAADQRKQRFHSVHGDHLTLLNVFRGWEQSGRS
RSWCAENFVQERAMWRAFEVRKQLAAIMVRFRLDVHGSDASAVRKAFCAGYFRNSAKRDP
HEGIFTTLVDQTPVHLHPSSAVYGKSVDYVIYHTLLLTTKEYMHCVSVVDPKWLVELAPR
FFQPSDPNNPSERRKRQKIVPLFNRFAENQDSWRLTAQVEEKKRALGRLNQ
NT seq 3396 nt NT seq  +upstreamnt  +downstreamnt
atggttggttggttgaaatatgtagactctattagtatcgcctgcacctggccatataac
catctcatggcgatgcgcctaaacttcatgtctggccctcttttgaaaaaagttgccgcc
gccgtcgaaaaacatttgggcgtggccgactcggacgagacgctctcgcggtttcttcta
agtttgtacgaggagccgttggaggcgttttctcgggcggtcgaggccaatggcggaagc
gactttccgcccgcgtttgtgcacgaggttttcgaggcgataagagaggagctgaaactg
aaagaactgaaagagctgaaactgaaagaactgaaagacggactgaagagagaagaacaa
gtggagacagagccagagaaccaggtgcatgaaaaaccagcggaaacgcaaagggaaagg
ctaccgtctgaaaggtccaaagacactggcacggagcagagaactcaaaaggatcacaac
aatcagcatcagagtcatcagaatcagaatcagaatcatcagcatcagaatcatcagaac
catcaagatcagcaaaatcagaatcagcaaaatcagcaaaatctacacgcccctgagcca
aaccttgtggtcggcgccgtctgccgcggaaccgtatccaacatcacgctgtatggcgct
ttcgtccgcctcaaccggttcgagtcgggcctctgccacatcagcaaaatgctgtacgat
gggcgccgcgtgggtctgcccggcgacgttgtgaagcagaaccaggaggtttttgtgcgg
atcacagacgttggctcgggccgccgccgcaaaatcgccctttccatggtgggcgtcgac
cagaccaacggcgagtatgtcgaggggcgagagtcggggcgacagtcggggcgcgacacc
gagtttgggcggcgcggccgagaaatggggcgcgaccgcgctgtttcttcaggcgcgcgc
cggctcacgtcgcccgagcgctgggaaatccgccagcttatcgccgccggcgcggctcgc
gcctcagactaccccgagttgtacgaggtcgaggaagacccggccgaaagcgagggcttt
gaagtggagatcaatccgcacgagccaaagtttttgcagggccaggtgcgggcgcgagcc
gaaccggcgcacattctcaaaaaccccgagggctcgttgtctcgggccgcgatggacggg
ctgcggttggcccaggaaatgagagagcagaagaaggagcagagaaagaaggagaagcag
cagggcaccgaagagaagaacaaagacaaagaacagaacaaagacaaagaacagagcaaa
ggcaaagaacaggctccatactccaagtctagaaaaaatgtttccaagtccgacctcgct
cagctgcgcaagcggcttcccgtctacgccatgcgcgaacagctcctctcggccgttcga
gacaaccaattcgtcattgtggtgggcgagaccggttcgggcaaaacgacccagatcgtc
cagtatctctacgaagaaaacttccaccgcggcgacaagatcattgcatgcacccagccg
cggcgtgtggcggccgagtccgtggcgaagcgtgtggcccaggaagtcgggtgtccgcta
ggccaggaggtgggatacaccattcgtttcgacgaccgcacgtcgcccgcgaccagaatc
aagtacatgaccgacggtatgcttcagcgcgaggcgttgctcgacccgcagatgctgaag
tatgcggtggtgatgttggacgaggcgcacgagcggactgtggccaccgatgtgcttttc
gctttgctcaagaaggcggcgcgggccaacccggaccttcgtgttctcgccacgtccgcc
acgcttgatgccgacaagttctcgcgctattttggcggctgccctgtgcttcatgttccc
gggcggacttttcccgttgaaatcatgtactcgcgggaaccagagcccgattacgtggcc
gcagctcttgactgtgtgatgcagatccacgtggccgaagactcgggcgacattcttgtg
tttcttaccggtcaggacgagattgacacctgctgcgaggcgctcgaggcccgtatcaag
acgttgggccgtgccgtgccggaacttctagttttgcctgcctactcggctttgcctcct
gaccaacaggcacgaatcttcgagccggcgccgcctggcgcccggaaagtggtattggct
acaaatatcgccgaaacgtccatcaccatcgatggcatccgctatgtggtagacccgggt
tttgtcaagctcaacgcctacgacccgcggcttggaatggacctgttggttgtgtcgccc
atttcgcaggctcaggccaatcagagaagcggaagagcaggcagaacagcaccaggcaag
tgtttccgtctctacacggaagaggctttccgcacagaaatgcggccaaacactgttccc
gagatccagagacagaacttggagcacaccatcttgatgctcaaggcgatggggatcgat
gatgtgctccgattcgagttcatggaccctcctccggctccaaccacagtacaggcgttg
aaagagctctatgttcttgatgcgctcgacgaaaacggccatctcacctcgatgggccgc
cgcatggccgatttcccgatggagcctgcgcttgcgaaaacggtcctagccagtgtggat
ctttcgtgtgcttcggacgttttaagcgtggtggccatgttatcggtgcagaatgtgttt
tatcggccaaaggacaaacaggccgccgcagaccagcgaaaacagcgtttccatagtgtc
cacggcgaccatctcactcttttgaatgttttccgtggctgggaacaatcaggtcgctcg
cggtcgtggtgtgccgagaattttgtccaagaacgagccatgtggcgagcttttgaagtt
cgcaagcagctcgcggccattatggtgcggtttcggcttgatgtccatggatcggacgcc
tctgctgtccgcaaggcgttttgtgcgggctacttccgcaatctggcgaagcgagacccc
cacgaaggaatctttactactttggtcgaccagaccccagtgcatttgcatccgctgctg
gcagtgtatgggaaaagtgtggactatgtgatttaccacacacttcttctcactacaaaa
gagtatatgcattgtgtcagtgtcgttgatccaaaatggcttgttgaattggcgccgcgg
ttcttccagcctagcgaccctaataacccgagcgaacggcgcaagaggcagaagattgtt
ccactcttcaatcggtttgctgaaaaccaggactcttggaggttaactgcacaagtggag
gaaaagaaacgggccttggggcgtttgaaccagtga

DBGET integrated database retrieval system