KEGG   Clavispora lusitaniae ATCC 42720: CLUG_05099Help
Entry
CLUG_05099        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00010  Glycolysis / Gluconeogenesis
clu00071  Fatty acid degradation
clu00350  Tyrosine metabolism
clu01100  Metabolic pathways
clu01110  Biosynthesis of secondary metabolites
clu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLUG_05099
  Lipid metabolism
   00071 Fatty acid degradation
    CLUG_05099
  Amino acid metabolism
   00350 Tyrosine metabolism
    CLUG_05099
Enzymes [BR:clu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CLUG_05099
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C NAD_binding_7 ThiF Shikimate_DH Glu_dehyd_C Pyr_redox XdhC_C adh_short FAD_binding_3 3HCDH_N UDPG_MGDP_dh_N TrkA_N Pyr_redox_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 8495579
NCBI-ProteinID: XP_002615084
UniProt: C4YAG1
AA seq 351 aa AA seqDB search
MSIPSLQVGYGIVHGNQKLVRFDNLPVPEPQAGEVLLKIEAAGLCRSDFHILIVQDPRLP
KKMVMGHEVCGSIAKVGPSLKDNASYSIGKKFALVIADACGTCSNCRKGVDNLCSGNQDK
AYGISQDGGFQQFLLVKNPRSLVEIPENVSFAEAAAASDAILTPFHAIMKVRHLLAPTTK
VLVFGAGGLGLNAVQILANFGCHIVVVDRKPGNEEIAKKFGAAEFYTNADEIAHDPESFQ
VCLDFVGNQETSDGCVEYIAPAGKILSVGLGKMRLNIPNYDLARREVEYIFNFGGTSEDQ
AQVLQWISLGKLKPLVTTTSMDQLPAYFEKMAKGEIVGRVAFVPNERPSKL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattccgtcattgcaagttgggtatggaattgtgcatgggaaccaaaaactagtt
cgttttgacaaccttcctgtgccagaacctcaagccggagaagttcttcttaagatcgaa
gcagctggcttatgccgttcagacttccacattttgatagtgcaagaccccaggctaccc
aaaaaaatggtaatgggccatgaagtgtgtgggtccattgctaaagttggtccgtcgctc
aaagacaatgcttcttacctgattgggaaaaagttcgctttggtgatagcagacgcttgt
gggacgtgcagcaattgccgaaagggggttgataacttgtgcctggggaaccaagacaaa
gcctatgggatcagtcaagacggaggattccagcagttcttgttggtgaagaatccacgg
tctttagtggaaattcccgaaaatgtgtcgtttgcagaggcagctgccgcttcggacgcc
attcttacgcctttccatgcaatcatgaaggtgagacacctcttggctccaacgacgaaa
gtgcttgtttttggtgctggtggtttgggtctcaatgcggtacagatacttgccaatttc
ggatgtcatatagttgtggtggatcggaaaccgggcaacgaggaaattgcaaagaagttt
ggagcggcagagttctatacaaatgctgacgaaattgcccacgatccggaatctttccag
gtctgtctcgattttgttggaaaccaagagacttcggatggatgtgtcgagtacatagcc
cctgcggggaaaatcttgctggttgggttgggcaaaatgcgcttaaacatccccaactac
gacttggctcgaagagaagtagagtacattttcaatttcggcggaacgtcagaggaccaa
gcccaagtgctacagtggatcagcttaggtaagcttaaaccattggtcaccacaacttcg
atggatcagcttccagcttattttgaaaaaatggccaagggcgagattgtgggtcgagtt
gcgtttgttccaaacgaacggccttcaaaattgtag

DBGET integrated database retrieval system