KEGG   Clavispora lusitaniae ATCC 42720: CLUG_05242Help
Entry
CLUG_05242        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K00866  choline kinase [EC:2.7.1.32]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00564  Glycerophospholipid metabolism
clu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CLUG_05242
Enzymes [BR:clu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     CLUG_05242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase Choline_kin_N APH
Motif
Other DBs
NCBI-GeneID: 8495184
NCBI-ProteinID: XP_002614464
UniProt: C4YAL4
AA seq 543 aa AA seqDB search
MDITPAHGSRHRSRSSSRTRNSTANSRSTSASRRPSLSGSRRSLSSASLNRLVITPTAID
LLQERTVPSINVVLDNSLPLDFFKQELIGLIKALRISKWHKRQLTVSNMSVTRISGALTN
SIYKIEYKDVSQQLSLPALLLRVYGKNVDSIIDRDSELQILIKLSAKKIGPKLLGIFENG
RFEQFLEGFITMGKDEIRNPVISQMLGRRMKDLHYKIDLDEQDRQLEFPVAWIQIMKWMR
LLETQILPSYDPKDVEDALLMPWAKFKEVVFSYREWLFAKYDTNKLYENYRFCHNDTQYG
NLLLRSSFEPMDVVQGEANNLSTSNKRDRDLAVIDFEYSGVNFAAYDIADHFSEWMSDYH
DADKPYFIHDDKYPSLKEQMNLLMSYIEYDFQFPTSNFITKNPVDANSDQKTIMEYEAKK
LYNEVIFWRATVQIFWSIWGLIQNGPNEKRSDVDDLSSRSEEQGVNSTYSITTGLDSVNI
SENAIEEEAITSTDDDFDYLKYTQQKAALIAGDFISFGLLSISDIDPKYHNVIKFLDTQV
LDV
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggacatcaccccagcccacggatccagacaccgttccagatccagctccagaacgaga
aactcgaccgcaaactcgagatcaacttcggccagccgaagaccctctttgagcggatct
cgccgctctttatcttctgcttccttaaaccgattggtgattacgccaaccgccattgac
ttgttgcaggagcggactgtgccgagcatcaatgttgttcttgataactctttgccgttg
gatttcttcaagcaggaacttattggactcatcaaggcgttgagaatcagcaaatggcac
aaacgccagttgacggtgagcaatatgctggtgactagaatctcgggcgctctcacgaat
tccatttataagattgagtataaggatgtatcgcagcaattgtcgcttcctgcgttgctt
ttgcgagtgtatggcaaaaacgtcgactcgattattgatcgagactcggagttgcagatt
ctcatcaagctttcggccaagaaaatcggtcctaagctcttggggatctttgagaacggc
cgctttgagcagttcttggaaggttttatcaccatgggtaaagatgaaatccgtaatcct
gtgatttcccaaatgttgggccgtagaatgaaagatctccactataaaatcgatttggat
gaacaggaccgccaattagagttccctgttgcatggatccaaatcatgaagtggatgcgt
ttattggagactcaaatcttgccttcctacgatccgaaagacgtggaagatgctttgtta
atgccatgggcaaagttcaaagaagtggtcttctcatacagagaatggctctttgccaaa
tacgacacgaacaagttgtatgagaactaccgcttttgccataatgatactcagtacgga
aatttgttattgagaagttcttttgaacccatggatgtggttcaaggagaagcaaataac
ctcagcacgagtaacaaaagggacagggacttggctgtgattgactttgaatactctggt
gtcaactttgctgcgtacgacattgcagaccatttctctgaatggatgtctgattaccac
gacgcagacaagccgtacttcattcatgatgacaaatatccgtcgttaaaggaacagatg
aacttgctcatgtcttacatcgagtacgactttcaattcccgacatcgaactttatcacc
aagaatcctgttgatgcgaacagtgatcaaaagactattatggagtacgaggccaaaaag
ctctacaatgaagtgattttctggcgagccacagtacagattttctggctgatttggggg
cttattcagaatgggcctaacgaaaagagaagtgatgttgacgatttgagctcgagatct
gaagaacaaggtgttaacagtacttatagcatcaccacaggcttggactcggtcaacatc
agcgagaatgcaattgaagaagaagcaatcacttcgacagatgatgatttcgattactta
aagtacacccagcaaaaggctgcgcttattgctggtgacttcatttcgtttggtcttctc
agcatttcagatatcgatccaaagtaccacaacgtcatcaagtttttggacactcaggtt
ttggatgtttaa

DBGET integrated database retrieval system