KEGG   Clavispora lusitaniae ATCC 42720: CLUG_05522Help
Entry
CLUG_05522        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
Organism
clu  Clavispora lusitaniae ATCC 42720
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 8495102
NCBI-ProteinID: XP_002614744
UniProt: C4YBE4
AA seq 360 aa AA seqDB search
MEKMFSLRAHAAPVSGFCPWENQLVSADRSGTLIVWNLSTRRPAARFRAHEGQVLSMQPT
RFGLLTHGRDSAVRIWPPGAAENSKGGDPHPIFEMPVNALNFCNVAYIDGADGTALLATP
ASVDSDCFDVYRLSPDFSLARAVENQAPKQEQRGADQIEEIGAPPGRGEGIIMRLAWAAP
DLLYVGYESGALASFSLSPEGCRMLWLARAHSPHPVLSLALEGARVYSGSAAKTLLVHEP
PHEEAVAKHNLGHYGVQCFEILPHLYLAGFWDGSVAGFSRDWQQLFSLERPHEQIEAPES
PSRKSLCLFVWSAPAAPEQSRRDRLRSRRAAGRLLFVGHADGLIVAYAIDESSENGLLES
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatgttttccctccgggcccacgcggcgccagtgtctggtttctgcccctgg
gaaaaccagcttgtttccgcagaccgcctgggcacattgatagtgtggaatctctccacg
cggcggcccgcggcccgtttccgcgcccacgagggccaggttttgtcgatgcagcccacg
cgcttcggccttttgacccatggccgcgactcggcagtgcgaatatggccgcccggcgcg
gcggaaaacagcaagggcggcgatccccatcccatctttgaaatgcccgtcaatgccctc
aatttctgcaatgtggcgtacatcgacggcgccgacggcactgcgctactcgccacgcct
gcctcggtggactcggactgtttcgatgtgtaccggctctcgcccgatttttcgctcgcg
cgcgcggtggaaaaccaggcgcccaaacaagaacaaagaggagcggaccaaatcgaggaa
atcggcgccccgcccggccgcggcgaaggcatcatcatgcgcttggcctgggcggcgccc
gacttgctctatgtgggctatgaatccggcgcccttgcgtcgttttccctctcgcctgaa
ggctgccgcatgctttggcttgcgcgcgcccactcgccgcatcccgtcttgtcgcttgcg
cttgaaggcgcgcgggtatattctggctcggcagcgaaaacacttttggtccacgagccg
ccgcatgaggaggcggtcgcaaaacacaacttgggccactatggcgtccagtgttttgag
atcttgccgcatctttacttggcaggcttttgggacggtctggtggccgggttctcgcgc
gactggcagcagcttttcagtctcgagcggccgcacgagcagatcgaggcgcccgagtcg
ccgctgcgcaaatcgctctgtttgtttgtgtggagcgcgccggctgcgcccgaacagtcg
cgccgcgaccgccttcgactgcgccgcgcggcggggcgcttgctttttgtaggccacgcc
gacggactaatcgtggcatacgctatcgacgaactgctggaaaatgggcttctagaatca
taa

DBGET integrated database retrieval system