KEGG   Clavispora lusitaniae ATCC 42720: CLUG_05823Help
Entry
CLUG_05823        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K10739  replication factor A2
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu03030  DNA replication
clu03420  Nucleotide excision repair
clu03430  Mismatch repair
clu03440  Homologous recombination
Module
clu_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:clu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CLUG_05823
   03420 Nucleotide excision repair
    CLUG_05823
   03430 Mismatch repair
    CLUG_05823
   03440 Homologous recombination
    CLUG_05823
DNA replication proteins [BR:clu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    CLUG_05823
DNA repair and recombination proteins [BR:clu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     CLUG_05823
   MMR (mismatch exicision repair)
     CLUG_05823
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     CLUG_05823
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA_anti-codon RPA_C RMI2 Rrf2
Motif
Other DBs
NCBI-GeneID: 8494654
NCBI-ProteinID: XP_002614337
UniProt: C4YCI4
AA seq 294 aa AA seqDB search
MQIRHRTRTNPKLHAWWAMGWYHVTMPIIATRSYSSFLSLLFKMDTSYGNYGDGGFSTDA
QFNEYNTSQRAQQTRSTLSPVTIKQINDATQPVSDGEFVVNNVSLNMVSFVGVVRKVENT
TSAHTITIEDGTGSVDVRRWVDEKVTTAAQETERFSALENKYVYVTGALKEFNQKKNVQH
ATIREITDHNEVLYHMLYAISNHLEAQGLMKTEPKAENGLFVQGTSAAGSGLDVLDKIMA
LIAANTPSMPEGVPTTWISDNLGLSVDEVKEKCHQLSEMAKIYQGYDEASYLSI
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattcgtcaccgaactagaacaaacccgaaattacatgcctggtgggccatgggt
tggtatcacgtgaccatgcccattatcgcgacgcgttcctactcgtcttttctttctctt
ctctttaagatggatacgagttatggaaactacggcgacggtggattttccacagacgct
caatttaacgaatacaacacgtcccagcgtgcccagcaaactagatcaactttaagtccc
gtgaccatcaagcaaatcaacgacgcgactcagccagtttccgatggcgagtttgtggtt
aataacgtgtctttgaacatggtttcgtttgtcggggttgtccgcaaggtggaaaacacc
accagtgcccatactatcaccattgaagacggaacagggtctgtggatgttaggagatgg
gtggacgagaaagtcaccaccgcggctcaggaaaccgagcggttcctggcattggagaac
aaatacgtgtacgtgacgggcgcattgaaggaattcaaccagaagaagaacgtccagcat
gccaccatccgtgagatcaccgaccacaacgaggtgttgtaccacatgctatatgctatt
tccaaccacttggaggcgcagggcttgatgaagactgaacccaaggctgaaaacggcttg
tttgtgcagggcacgctggccgctggtctgggcttggatgttttggataagatcatggct
cttattgcagcaaacacgccttccatgccagaaggcgttccaacgacgtggattagtgat
aacttgggtctctctgtggatgaggtcaaggagaagtgccaccaattgtctgagatggca
aaaatctaccagggctacgatgaggcgtcgtacttgagtatttaa

DBGET integrated database retrieval system