KEGG   Clavispora lusitaniae CBS 6936: A9F13_06g00759Help
Entry
A9F13_06g00759    CDS       T05147                                 

Definition
(GenBank) putative malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
clus  Clavispora lusitaniae CBS 6936
Pathway
clus00620  Pyruvate metabolism
clus00630  Glyoxylate and dicarboxylate metabolism
clus01100  Metabolic pathways
clus01110  Biosynthesis of secondary metabolites
clus01200  Carbon metabolism
Module
clus_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:clus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9F13_06g00759
   00630 Glyoxylate and dicarboxylate metabolism
    A9F13_06g00759
Enzymes [BR:clus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     A9F13_06g00759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: OVF08950
UniProt: A0A202G8C1
AA seq 551 aa AA seqDB search
MSSPFPTTASKAHGVQILGPIPSNAKHIFTPETLAFVATLHRNFQGQRKKLLAARKEQQK
LRDSGVLPDFLPETAHIREDPTWTGPPLAPGLRDRRVEITGPTDRKMVINALNSGVATYM
ADFEDSLTPAWDNLVDGQVNLYDAVRRNLSFSSNGKEYRLKVEPGKYIPTLIVRPRGWHL
DEKHVLVDGEPVSGGIFDFAVYFFNNAKEAIAQGFGPYFYLPKMEHHLEAKLWNDIFNHA
QDYIGIPRGTIRGSVLIETLPAAFQMDEIIYQLRSHIGGLNCGRWDYIFSYIKSLRNHKE
FILPDRSQVTMAAPFMSSYVKLLVHTCHKRQVHALGGMAAQIPIKTDEARNRAALENVAK
DKLREVLAGCDSCWVAHPALVPVVLKVFNEHMKGPNQINVPPREPYKPVTARDLLSPFVP
GAKITEQGIRANCIIGLSYIEAWLRNVGCVPINYLMEDAATAEVSRTQLWQWVTHGATTD
TGKLIDKSYVSKLLTEEYEKLVKAAKPGNKFKRALEYFKPEATGEKYSDFVTTLIYNDVT
TIGRPITAEKL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctccttttccaaccactgccctgaaagcccacggggtgcagattttgggtccg
atcccatccaatgccaagcacattttcactccagaaacgttggcttttgtcgccacgttg
caccgcaacttccaaggccagaggaagaagttattggctgccagaaaagagcaacaaaaa
ttgagagattctggtgtgttgccagactttttacctgagactgctcacatcagagaagac
cccacttggactggtcctccattggctcccggcttgagagaccgtagagtcgagatcacg
ggcccaaccgacagaaagatggtgattaatgccttgaactctggtgtggctacatacatg
gcagatttcgaagactccttgactccagcatgggacaatttggttgatggccaagtcaat
ttgtacgacgctgtgagaagaaacttgtccttttcttccaatggtaaggaatacaggctc
aaggttgaaccaggaaagtacatccccacattgattgtacgcccaagaggatggcatttg
gacgaaaaacacgttttggttgacggtgaacccgtttctggtggtattttcgactttgct
gtgtactttttcaacaatgctaaggaggccattgcacagggttttggcccttacttctac
ttgcccaagatggagcatcacttagaggccaagttgtggaacgatatcttcaaccatgca
caagactacattggaatcccaagaggaaccatcagaggatctgttttgattgaaacttta
cctgctgctttccaaatggacgagattatttatcaattgagatcgcacattggtggcttg
aactgtggaagatgggactacatcttctcatacatcaagtcattgagaaaccacaaggag
ttcattttgccagacagatcacaggtgaccatggcagctccattcatgtcatcttatgtt
aaactcttggtgcacacatgccacaagagacaggttcacgctttaggtggaatggccgca
cagatccctatcaagacagatgaggccagaaacagagctgccttggaaaatgttgccaaa
gacaagttgcgtgaggttttggctggctgtgactcatgctgggtcgcacatccagctttg
gttccagtggtgttgaaggttttcaatgagcacatgaaaggccctaaccaaatcaatgtt
cctccaagagaaccctacaagccagttactgcaagagacttgttgagtccatttgttcct
ggtgcaaaaatcaccgaacaaggtatcagagccaattgtatcattggtttgtcatacatt
gaggcttggttgcgtaacgttggatgtgttccaatcaactacttgatggaggatgccgcg
accgcggaagtatctagaacccaactctggcagtgggttactcatggtgctactactgac
accggcaagctcatcgacaagtcttacgtctcgaagcttttgacagaggaatacgagaag
ttggtgaaggcagcaaagccaggtaacaagttcaagagagctttggagtacttcaagccc
gaggctactggagagaaatactctgactttgtcaccacattgatctacaatgatgtcacc
acaattggcagacctattacggctgagaaattgtag

DBGET integrated database retrieval system