KEGG   Clavispora lusitaniae CBS 6936: A9F13_12g01540
Entry
A9F13_12g01540    CDS       T05147                                 

Definition
(GenBank) putative delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
clus  Clavispora lusitaniae CBS 6936
Pathway
clus00100  Steroid biosynthesis
clus01100  Metabolic pathways
clus01110  Biosynthesis of secondary metabolites
Module
clus_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:clus00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    A9F13_12g01540
Enzymes [BR:clus01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     A9F13_12g01540
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-ProteinID: OVF07610
AA seq 441 aa
MASLNPKTTEKEFFGMFGALGIPIFLPLLIIFFQLITNSHYAIKGISLDLSKVIEQIPQS
WSELADICFDKKCWVVYLVWFFVLAVFDVYSPGRDVEGVELRDGTKLMYRINGRFMSSLL
VVIIVARAFASENFYLPELQFLYDNQLQLTMVTIIFSFLLSFFVYFCSFIPLRRPNGAKT
NERILSINGNSGNAIYDWFIGRELNPRIGSWDIKLFCELRPGMLLLFLINLSCLHQQYHT
QGKVADSMWLVNAMQAFYIFEGVLNEEGCLTMMDIATDGFGFMLAFGDLAWLPWSYSLQA
RYLALPGNAYHLGWLKCSLILLVNVLGYYIFHSANQQKSDFKQGKLKHLKSITTPTGSKL
LADGWWSTSQHINYFGDWLIGWSWCLPTGTMTLLTYFYVIYFGVLLVHRQTRDEAKCRNK
YGKAWEEYEKQVPYKIVPYVY
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggcactgttgaatcctaaaacgacggagaaagagtttttcggcatgtttggtgcccta
ggcatcccaatattcttgcccttgctcattattttcttccaattgatcacgaactctcat
tacgccatcaaaggtatcagtctcgacttgtctaaagttatcgagcaaatcccccaatcg
tggagtgaactagcagatatttgcttcgacaagaaatgttgggttgtctatcttgtgtgg
ttcttcgttcttgctgtatttgatgtctactctccaggcagagatgttgaaggtgttgaa
ttaagagacggaacgaagttgatgtaccgtattaatggtcgtttcatgtcctctttgttg
gtagtaatcattgttgcaagggcatttgcgtcagaaaacttttacttgccggaattacag
ttcctctatgacaatcagttacagttgacaatggttacaattattttctcattcttgcta
tccttcttcgtttacttttgctccttcatcccattacgccgccctaatggtgccaagaca
aacgaaagaatcttatccatcaacggaaactctggtaacgcaatctacgactggttcatc
ggaagggagttgaacccaagaattggttcttgggacatcaaattgttctgcgaactcaga
ccaggcatgcttttgctattcttaattaacttgtcatgtcttcatcaacaataccacacc
cagggaaaagtggctgattcaatgtggttggttaacgccatgcaagcattttacatcttt
gaaggtgtccttaatgaagaaggttgtttgaccatgatggatattgctaccgatggattc
ggctttatgcttgcctttggtgacttggcttggcttccgtggtcgtactcattacaggct
cgctacttggcattaccaggaaatgcataccacttgggctggctcaaatgctctctcatt
ttgttggtgaacgttttgggttactatattttccactctgccaatcagcagaaatcggac
tttaagcagggcaaattaaagcacttgaaaagcatcacgacacccacaggctcgaaatta
cttgctgacggttggtggagcacgagtcagcatatcaattacttcggagactggcttatt
ggctggtcttggtgcttacccacgggcactatgactttactcacatacttttacgtcatt
tactttggcgttttgttggttcacagacagactcgtgatgaagccaagtgtagaaacaaa
tatggcaaggcgtgggaggagtacgagaaacaagttccatacaagatcgtgccatacgtt
tattaa

DBGET integrated database retrieval system