KEGG   Clavispora lusitaniae CBS 6936: A9F13_21g00803Help
Entry
A9F13_21g00803    CDS       T05147                                 

Definition
(GenBank) putative methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
clus  Clavispora lusitaniae CBS 6936
Pathway
clus00450  Selenocompound metabolism
clus00970  Aminoacyl-tRNA biosynthesis
clus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clus00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    A9F13_21g00803
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A9F13_21g00803
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:clus01007]
    A9F13_21g00803
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:clus03016]
    A9F13_21g00803
Enzymes [BR:clus01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     A9F13_21g00803
Amino acid related enzymes [BR:clus01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   A9F13_21g00803
Transfer RNA biogenesis [BR:clus03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A9F13_21g00803
 Prokaryotic type
   Other AARSs
    A9F13_21g00803
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: OVF06250
UniProt: A0A202G0L1
AA seq 569 aa AA seqDB search
MKRFPLKALSKRFSRYKSNGTVYVTTPIFYVNARPHLGHLYSMLLGDTRVRWENLKPGQK
TMFLTGTDEHGLKIQAVAEKEGIDPKVLVDRVSQNFVQMAEAVNVKYDRFIRTTDNDHVK
AVEHFWNAAMEKGLIYKGSHSGWYSVSDEAFYPPSQVEDIIDAKTGQPKKVSIETRNEVV
FQEEENYFFRLSAFKDKLIDFLEKNPSFVQPSRKYHELLTELRQEELSDLSVSRPSWRLK
WGITVPNDDSQKIYVWFDALINYLTAAGYPQQDMPIWPPIHIVGKDIMRFHCIYWPIFLM
AAGIELPKQVIVHSHWLCDGFKMSKSLGNVVEPIELAQYYDPEPLRIYLMEQSNLGTDCN
FSEAALHNHRSKLINKWANIVSRIGGDKFDVEQSVQDFFDGKYSDITEMIKRDAVVEAPD
QVLLARDSLVSSISSLFSEMDSSMQEFGQMKALHRWWETVELANVFFQTAQPWVYSKKLT
QTQDADADAAEEQKTLMNYIIFLTAEAVRVSTICVLPFMPKTASGLLDRLGVPDETRNKD
FAKLGTVKYGKNANSKHHKPLMRKVESRV
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaagagattcccacttaaagcgctatcaaagcggttctcgagatataagtcaaatgga
actgtttatgtcacaactcccattttctatgtcaatgcacgccctcatttgggtcaccta
tactcgatgcttttaggagacacgcgagtacgatgggaaaacctcaagccgggtcaaaag
acaatgtttcttacagggacagacgagcatgggctcaaaattcaggcggtggcagaaaaa
gaaggcattgatcccaaagtcttggtcgatcgagtctcgcaaaactttgttcagatggcc
gaggcagttaatgtgaagtacgatcgttttatcagaacaaccgacaacgaccacgtgaaa
gctgtagaacacttttggaatgcagctatggaaaaggggctcatatacaaaggttcccat
agtggctggtatagtgtaagcgacgaggctttctaccctcctagtcaggtggaagatatt
attgacgcgaaaacgggccaaccgaagaaagtgtcaatagaaacaaggaatgaagtggtg
ttccaagaagaagagaactactttttcagattgtctgccttcaaggataagcttattgat
ttcttggagaagaacccttcgtttgtccagccgagcagaaaatatcatgagctattgacc
gaattgagacaagaggaactttcagacctttccgtatcacgcccatcttggagattgaaa
tggggaatcactgtgcccaatgacgactctcagaaaatctatgtatggtttgacgcgctt
atcaactaccttactgctgctggctatcctcagcaagatatgcctatctggcctccaatc
catattgtcggaaaagacatcatgaggtttcattgcatttattggccaatctttctcatg
gcagccggaatcgaattacctaagcaggtgattgttcactcccattggttatgtgacggt
tttaaaatgagcaaaagcctagggaatgttgtggagcccattgaattggcgcagtactac
gatccagagccattgaggatctatttgatggagcaatcgaatttaggaacagattgcaat
tttagtgaagctgctttgcacaaccacagaagcaagctcataaataaatgggcaaacatt
gtgtctagaattggaggagataaatttgatgtggaacaaagtgttcaagacttctttgac
gggaaatatagcgatattacagagatgattaaacgtgacgctgttgtcgaggcacctgac
caagttttacttgccagggactcccttgtatccagtatctcatctttattttctgaaatg
gattcaagcatgcaagagtttggacaaatgaaggcactccatcggtggtgggaaacggtg
gagttagcgaacgtatttttccaaactgctcaaccgtgggtttatctgaagaaacttaca
cagacgcaagatgctgatgctgatgcagctgaagagcagaagacactcatgaactacatt
atcttcttaacagcagaggctgtacgagtcagtacaatctgcgtacttcctttcatgccc
aaaactgcctcaggacttcttgatcgcttgggggttccagatgaaacccggaataaagat
ttcgcaaaattaggcacagtaaagtacgggaaaaatgccaatagcaaacatcataagcca
ttgatgagaaaagtggaaagcagagtgtaa

DBGET integrated database retrieval system