KEGG   Clavispora lusitaniae CBS 6936: A9F13_23g00715Help
Entry
A9F13_23g00715    CDS       T05147                                 

Definition
(GenBank) putative 4-nitrophenylphosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
clus  Clavispora lusitaniae CBS 6936
Brite
Enzymes [BR:clus01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     A9F13_23g00715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase
Motif
Other DBs
NCBI-ProteinID: OVF05455
UniProt: A0A202FY42
AA seq 308 aa AA seqDB search
MSSKITDKTQAQSVIDNYEYFIFDCDGVIWLGDHLLPSVVETLNLLKEKKKKVIFVTNNS
TKSRNDYLSKFKKLGINGIVKDEVFGSSYASAVYVDKILKLPKDKKVWVLGESGIEQELH
ELGYQTVGGSDPALVSEGNVFDPEHKMLNELDDSVGCVIAGLTMNINYLKLSVTMQYLLK
DNKSIPFIATNIDSTFPSKGTFLIGAGSIIATVATASGREPDAICGKPNQSMMNTIKVDN
PALAENPKKGLMIGDRLNTDMKFGRDGGLDTLLVLTGVETEEGVKQLSADEAPTYYADKL
GDLFELTH
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaaaattacagacaagacgcaggcacaaagtgtcattgataactacgaatac
tttatcttcgattgcgacggagtgatttggttgggagaccacttattaccatctgtcgtg
gagacgctcaacctcttgaaagaaaagaagaagaaggttatttttgtcaccaacaactcg
accaagtccagaaatgattacctttcaaagttcaagaagcttggtatcaatggtattgtc
aaggatgaagttttcggctcatcgtatgcttctgccgtttatgtggacaagattttgaag
cttccaaaagacaagaaagtttgggtcctaggcgaatcaggaattgaacaagagctacac
gaactaggataccaaactgtgggaggctcggatcctgccttggtttccgagggtaatgtg
tttgacccagaacacaagatgttgaacgaattagacgattctgttggatgtgtgattgcg
ggattgaccatgaacatcaactacttgaaactctctgtgaccatgcaatacttgctcaag
gacaacaagagcattccattcattgcaacgaacatcgactctacgtttcctctgaagggg
acgtttttgatcggcgcaggatccattatcgccacagttgccactgcgagcggcagagaa
ccggacgccatctgtggtaagcctaaccagtcgatgatgaacaccatcaaagtggacaat
cctgcattggcagagaatccgaagaaggggttgatgattggtgatagactcaacaccgat
atgaagtttggacgcgacggcggtttggacaccttgttagttctcacaggagtggagaca
gaagaaggtgttaagcaattgagcgcagatgaagcacctacgtattacgccgacaagctt
ggcgacttgtttgaacttacccactga

DBGET integrated database retrieval system