KEGG   Columba livia (rock pigeon): 102083620Help
Entry
102083620         CDS       T02912                                 

Gene name
CKB
Definition
(RefSeq) creatine kinase B-type isoform X1
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00330  Arginine and proline metabolism
clv01100  Metabolic pathways
Module
clv_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    102083620 (CKB)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     102083620 (CKB)
Exosome [BR:clv04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   102083620 (CKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 102083620
NCBI-ProteinID: XP_005506132
UniProt: A0A2I0MNQ5
Position
Unknown
AA seq 381 aa AA seqDB search
MPFSNSHNLLKMKYSAADEFPDLSTHNNHMAKVLTLDLYKKLRDKQTPSGFTLDDVIQTG
VDNPGHPFIMTVGCVAGDEESYEVFKELFDPVIEDRHGGYKPTDQHKTDLNADNLQGGDD
LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLSVEALGSLDGDLKGKYYALRNMT
DAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDKKTFLVWINEEDHLRVISM
QKGGNMKEVFNRFCTGLTKIETLFKSKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
HLGKHEKFGEVLKKLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLL
IEMEKRLEKGQSIDDLMPAQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcccttctcaaacagccacaacctcctgaagatgaagtactctgctgctgatgagttc
cctgacctgagcactcacaacaatcacatggctaaagtgctgaccctggacctgtacaag
aagttgagggataaacagactcccagtggatttaccctggatgatgttatccagactggg
gttgacaacccaggccatcccttcataatgacagtaggatgcgtagctggtgatgaagaa
tcctatgaggtgtttaaggaactctttgatccagttattgaagacagacatggtggctac
aaaccgactgatcagcacaagactgacttgaatgctgataacctgcaggggggtgatgac
ctggatcccaattacgtgctgagttcccgtgtcagaactggtaggagcatccgtggattc
tgtcttcccccacactgcagtcgaggagagaggcgggctatcgaaaagctctctgtggaa
gctctgggtagcctggacggtgatctcaagggcaagtactatgctctgaggaacatgact
gatgcggagcagcagcagctgattgatgatcacttcttgtttgacaagccagtttctcct
cttctgttggcatctggaatggcaagagattggcctgatgccaggggtatctggcacaat
gataagaagaccttccttgtttggatcaatgaggaggatcaccttagagttatttccatg
cagaaaggtggcaacatgaaggaagtctttaaccgcttctgtactgggctaacaaagata
gaaactctcttcaagtccaaaaactacgagttcatgtggaatccacacttgggctacatc
ctgacctgcccatccaaccttggaacagggcttcgtgctggtgtgcacattaagctacca
caccttgggaaacatgagaagtttggagaagtcctcaagaagcttcgcctgcagaaacga
ggcacaggtggtgtggacactgctgctgtcggaggagtgtttgatgtctccaacgctgat
cgtcttggcttctctgaggtggagctggtacagatggttgtggatggtgtgaagctgctc
attgaaatggagaaacgccttgaaaaaggccagtccattgatgacctcatgccagctcag
aaataa

DBGET integrated database retrieval system